نوع مقاله: مقاله پژوهشی

نویسندگان

گروه زیست‌شناسی، دانشکده علوم پایه، دانشگاه شهید مدنی آذربایجان، تبریز، ایران

چکیده

به رغم پیشرفت‌های چشمگیر در زمینه درمان سرطان، علاقه به طراحی داروهای جدید افزایش یافته‌است. برخی از پپتیدهای گیاهی طیف گسترده‌ای از فعالیت‌های سیتوتوکسیک را در برابر سلول‌های سرطانی نشان می‌دهند. هدف این مطالعه تجزیه و تحلیل آماری پپتیدهای ضد‌سرطان گیاهی شناخته شده و همچنین یافتن مهمترین ویژگی‌های مشترک بین آنها بود. در این راستا لیستی از پپتیدهای ضدسرطان گیاهی موجود در پایگاه داده (The Antimicrobial Peptide Database) تهیه و اطلاعات مربوط به هر پپتید استخراج شد. آنالیزهای آماری در محیط نرم‌افزار R Studio صورت گرفت. نتایج بیانگر آن بود که 55 مورد ثبت شده اغلب از نظر تاکسونومی متعلق به رده Malpighiales بودند. تقریباً 44 درصد پپتیدها طولی در بازه 25 الی 30 اسیدآمینه داشتند. هیستیدین و متیونین کمترین فراوانی را در بین اسیدآمینه‌های تشکیل‌دهنده پپتیدها داشتند. سیستئین، سرین و گلیسین فراوانترین اسید‌آمینه‌ها بودند. 91 درصد پپتیدها کمتر از 10 اسیدآمینه اسیدی و 71 درصد پپتیدها کمتر از 10 اسیدآمینه بازی داشتند. شارژ خالص 76 درصد پپتیدها بین 2- الی 2 بود. 64 درصد پپتیدها اندکس بومن کمتر از 1 داشتند. پایین بودن این اندکس نشانگر هیدروفوبیسیتی بالای این پپتیدها و افزایش احتمال برهم‌کنش آنها با سایر پروتیین‌هاست. همچنین مهمترین ساختار سه بعدی شناخته شده برای پپتیدهای ضد‌سرطان گیاهی حضور 3 پل دی‌سولفیدی بود. بنابراین تولیدکنندگان و طراحان دارو می‌توانند با استفاده از این ویژگی‌ها که از آنالیزهای آماری پیشرفته استخراج می‌شوند، نسبت به سنتز یا کشف داروهای موثر جدید با اثرات جانبی کمتر اقدام نمایند.

کلیدواژه‌ها

موضوعات

عنوان مقاله [English]

Statistical analysis of plant anticancer peptides using the R environment

نویسندگان [English]

  • Leila Zarandi-Miandoab
  • Elahe Zade-Hoseingoli

Department of Biology, Faculty of Sciences, Azarbaijan Shahid Madani University

چکیده [English]

Despite significant advances in cancer treatment, interest in the design of new drugs has increased. Some plant peptides show a wide range of cytotoxic activity against cancer cells. The purpose of this study was to investigate the recognition of plant anti-cancer peptides and also to find the most important common features among them. In this regard, a list of the antimicrobial peptides and information about each peptide was extracted. Statistical analyzes were performed using R Studio software. The results showed 55 plant anticancer peptides were taxonomically belonging to the Malpighiales. Approximately length of 44% of peptides was in the range of 25 to 30 amino acids. Histidine and methionine had the lowest abundance among peptide amino acids. Cysteine, serine and glycine were the most abundant amino acids. 91% of peptides had less than 10 acidic amino acids and 71% peptides had less than 10 basic amino acids. A pure charge of 76% peptides was between 2 and -2. 64% of peptides had a Bowman index of less than 1. The low index indicates high hydrophobicity of these peptides and increases their chances for interaction with other proteins. Also, the most important three-dimensional structure of plant anti-cancer peptides was the presence of 3 di-sulfide bridges. Therefore, pharmaceutical manufacturers and drug designers can use these features extracted from advanced statistical analyzes to synthesize or discover new effective drugs with less side effects.

کلیدواژه‌ها [English]

  • Keywords: Plant anticancer peptides
  • Statistical analysis
  • R studio environment

تجزیه و تحلیل آماری پپتید­های ضد­سرطان گیاهی با استفاده از محیطR

لیلا زرندی میاندوآب* و الهه زاده­حسینقلی

ایران، تبریز، دانشگاه شهید مدنی آذربایجان، دانشکده علوم پایه، گروه زیست­شناسی

تاریخ دریافت: 17/9/97                تاریخ پذیرش: 23/10/97

چکیده

به رغم پیشرفت­های چشمگیر در زمینه درمان سرطان، علاقه به طراحی داروهای جدید افزایش یافته­است. برخی از پپتیدهای گیاهی طیف گسترده­ای از فعالیت­های سیتوتوکسیک را در برابر سلول­های سرطانی نشان می­دهند. هدف این مطالعه تجزیه و تحلیل آماری پپتیدهای ضد­سرطان گیاهی شناخته شده و همچنین یافتن مهمترین ویژگی­های مشترک بین آنها بود. در این راستا لیستی از پپتیدهای ضدسرطان گیاهی موجود در پایگاه داده (The Antimicrobial Peptide Database) تهیه و اطلاعات مربوط به هر پپتید استخراج شد. آنالیزهای آماری در محیط نرم­افزار R Studio صورت گرفت. نتایج بیانگر آن بود که 55 مورد ثبت شده اغلب از نظر تاکسونومی متعلق به رده Malpighiales بودند. تقریباً 44 درصد پپتیدها طولی در بازه 25 الی 30 اسیدآمینه داشتند. هیستیدین و متیونین کمترین فراوانی را در بین اسیدآمینه­های تشکیل­دهنده پپتیدها داشتند. سیستئین، سرین و گلیسین فراوانترین اسید­آمینه­ها بودند. 91 درصد پپتیدها کمتر از 10 اسیدآمینه اسیدی و 71 درصد پپتیدها کمتر از 10 اسیدآمینه بازی داشتند. شارژ خالص 76 درصد پپتیدها بین 2- الی 2 بود. 64 درصد پپتیدها اندکس بومن کمتر از 1 داشتند. پایین بودن این اندکس نشانگر هیدروفوبیسیتی بالای این پپتیدها و افزایش احتمال برهم­کنش آنها با سایر پروتیین­هاست. همچنین مهمترین ساختار سه بعدی شناخته شده برای پپتیدهای ضد­سرطان گیاهی حضور 3 پل دی­سولفیدی بود. بنابراین تولیدکنندگان و طراحان دارو می­توانند با استفاده از این ویژگی­ها که از آنالیزهای آماری پیشرفته استخراج می­شوند، نسبت به سنتز یا کشف داروهای موثر جدید با اثرات جانبی کمتر اقدام نمایند. 

واژه­های کلیدی: پپتیدهای ضد­سرطان گیاهی، تجزیه و تحلیلآماری، محیط R Studio

* نویسنده مسئول، تلفن: 04133816856 ، پست الکترونیکی: ac.zarandi@azaruniv.ac.ir

مقدمه

 

سرطان بیماری مهلک و بزرگترین معضل بهداشتی نسل بشر امروزی است. علی­رغم پیشرفت­های چشمگیر در زمینه پزشکی، در قرن 21 سرطان بیش از سایر علل منجر به مرگ و میر می­شود و احتمالاً تعداد قربانیان تا سال 2030 به حدود 21 میلیون نفر خواهد رسید (13). تکثیر غیرکنترل شدهء سلول طبیعی باعث ایجاد بی­ثباتی ژنتیکی و تغییرات ناخواسته­ای می­شود که در نهایت سلول طبیعی را به یک سلول بدخیم تبدیل می­کند. به تعبیر دیگر انباشت تغییرات ژنی و بی­ثباتی کروموزومی در پاسخ به آسیب DNA سلولی منجر به سرطان می­شود (19). درمان موثر انواع تهدید­کننده سرطان تاکنون موفق نبوده­است. همچنین علاقه به طراحی داروهای جدید به علت افزایش مقاومت سلول­های سرطانی به داروهای ضد­سرطان فعلی افزایش یافته­است. یافتن راهکار فعال و پویا برای درمان سرطان اولویت  پژوهش دانشمندان علوم پایه، علوم پزشکی، داروسازان، متخصصین بیوتکنولوژی، ژنتیک و البته سیاست­گزاران عرصه بهداشت جوامع بشری است (14).  با توجه به اینکه بشر راه­حل اغلب مشکلات خویش را در ارتباط با محیط طبیعی اطراف خود یافته­است، به­نظر می­رسد گیاهان می­توانند مخزن با­ارزشی برای درمان سرطان باشند. اغلب راه­های فعلی کنترل و احتمالاً درمان سرطان تهاجمی هستند. به کاربستن اغلب چنین درمان­هایی با عوارض جانبی ناخواسته فراوانی همراه است. این در حالی است که به­نظر می­رسد گیاهان و محصولات مشتق شده گیاهی مزایایی همچون ساده، ایمن، کمتر سمی، کم هزینه، سریع و سازگار با محیط زیست را در مقایسه با روش­های معمول درمان سرطان دارند. جستجو برای یافتن کاندیداهای بالقوه که بتوانند رشد سلول­های سرطانی را بدون عوارض جانبی کُند یا مهار کنند از بین مواد و ترکیبات گیاهی (Phytochemicals) نشان می­دهد که تعدادی از ترکیبات گیاهی از جمله (Taxanes و Colchicine) (8; 13; 22) و همچنین برخی پپتیدهای گیاهی این قابلیت را دارند. تا جایی که در حدود 60درصد داروهای ضد­سرطان موجود، بصورت مستقیم یا غیرمستقیم از سلسله گیاهی مشتق شده­اند. مطالعات اخیر حاکی از آن است که تعدادی از پپتیدهای ضد­میکروبی (Anti-Microbial Peptides) طیف گسترده­ای از فعالیت­های سیتوتوکسیک را در برابر سلول­های سرطانی دارا هستند.

پپتید به ترکیبات با بیش از دو اسید­آمینه که با پیوند پپتیدی به هم متصل شده­اند گفته می­شود که به فراوانی در همه موجودات زنده وجود دارند. هزاران پپتید از جانوران، گیاهان و میکروارگانیسم­ها استخراج شده­اند (16). در اوایل دهه 1990پپتیدهای کوتاه (در حدود 30 اسید­آمینه) که با و یا بدون نیاز به انرژی قادر به عبور از غشاهای سلولی بودند، کشف شدند که اغلب بار مثبت داشتند ولی تعدادی پپتید آنیونی یا هیدروفوب نیز در بین آنها وجود داشت. ویژگی دوگانه­دوستی اگرچه دیده می­شود ولی برای ورود به سلول ضروری نیست (2). علی­رغم پیشرفت­های بسیار در مورد کشف پپتیدهای ضدسرطان هنوز هم جستجوی آنها از منابع زیستی جدید مورد توجه دانشمندان علوم پزشکی و دارویی است (7; 14). به عنوان مثال جستجوی پپتیدهای ضد­سرطان پستان از موکوس ترشحی حلزون آفریقایی موفقیت­آمیز بوده­است (25). مزایای پپتیدها در مقایسه با سایر ترکیبات شیمیایی این است که بسیار انتخابی، با کارآیی بالا و از مسیرهای متنوعی عمل می­کنند، نسبتاً امن هستند، به خوبی تحمل می­شوند، وزن مولکولی­ کم، ساختار نسبتاً ساده، آنتی­ژنیسیتی و عملکرد نامطلوب کم دارند و آسان جذب می­شوند (16). بنابراین در طراحی و ساخت پپتیدهای ضد­سرطان باید به چندین ویژگی فوق­العاده آنها مانند اندازه کوچک، فعالیت بالا، ایمونوژنز کم، سازگاری خوب، تنوع توالی و تعداد زیاد سایت­های قابل تغییر و دستکاری روی توالی توجه کرد. با این حال، پایداری کم و نیمه­عمر کوتاه پپتید­ها موانع اصلی برای کاربرد هستند (12; 18). اخیراً دانشمندان سعی در جمع­آوری و طبقه­بندی اطلاعات موجود در این زمینه دارند تا بتوانند بر پایه اطلاعات موجود مسیر یافتن داروهای جدید و موثر را بهتر و سریعتر بپیمایند (23). به­نظر می­رسد استفاده از پپتیدهای گیاهی دارای فعالیت ضد­سرطانی بالا و پایدار در سرم به علت کاربرد آسان خوراکی گزینه مناسبی در موارد بالینی باشند. از نظر ساختار شیمیایی پپتیدها قابل تقسیم به دو گروه خطی و حلقوی می­باشند. اغلب پپتیدهای جداشده از گیاهان حلقوی هستند و سیکلوپپتید نامیده می­شوند. در مقایسه با پپتیدهای خطی، سیکلوپپتیدها قابلیت بیشتری برای فعالیت­های زیستی نشان می­دهند که احتمالاً بدلیل شکل و وضعیت پایدارشان در نتیجۀ ساختار حلقوی آنها می­باشد (16). در اغلب مطالعات مروری در این زمینه توجهی به پپتیدهای درمانی با منشاء گیاهی نشده­است (2; 7; 14; 25) بنابراین نویسندگان این مقاله سعی در معطوف کردن توجه محققین به پتانسیل بالای این نوع پپتیدها برای اهداف درمانی دارند. هدف این مطالعه تجزیه و تحلیل آماری پیشرفته پپتیدهای ضد­سرطان گیاهی شناخته­شده و همچنین یافتن مهمترین ویژگی­های مشترک بین آنها بود. در این راستا، تلاش شد از طریق بررسی جامع تمام پپتیدهای شناخته­شده گیاهی (تا دسامبر 2018) به چارچوبی مشترک برای بهره­گیری مستقیم و یا الگوبرداری جهت طراحی داروی ضد­سرطان، دست یافت. چنین پپتیدهایی به تنهایی یا در ترکیب با سایر داروهای متعارف می­توانند یک راهکار درمانی امید­بخش در درمان سرطان در نظر گرفته شوند.

مواد و روشها

جهت دستیابی به ترادف پپتیدهای موجود گیاهی که ویژگی­های ضد­سرطان از خود نشان می­دهند، به سایت پایگاه داده پپتیدهای ضد­میکروبی The Antimicrobial Peptide Database (APD) به آدرس http://aps.unmc.edu/AP/main.php  مراجعه شد. اطلاعات این پایگاه برای اولین بار در سال 2003 بصورت آنلاین ارائه شده­است و ارتقاء آن به نسخه­های بعدی به ترتیب در سال­های 2009 و 2015 انجام شده است (29). در این مطالعه از اطلاعات نسخه­ی سوم با نام APD3 استفاده شد که (تا زمان انجام پژوهش در دسامبر 2018) حاوی اطلاعات مربوط به 2169 پپتید ضد­باکتریایی، 172 پپتید ضد­ویروسی، 959 پپتید ضد­قارچی و80 پپتید ضد­انگلی است. در مجموع 185 مورد از این پپتیدها دارای تاثیرات ضد­سرطانی بودند که از میان آن­ها پپتیدهای با منابع تولید گیاهی به تعداد 55 پپتید، استخراج و در مطالعه حاضر مورد بررسی قرار گرفتند (جدول 1). تجزیه و تحلیل آماری داده­ها و اطلاعات مربوط به پپتیدها و همچنین رسم نمودارها با استفاده از نرم افزار RStudio  انجام شد (24). همچنین جهت بررسی درجه یا میزان حفاظت­شدگی اسیدهای­آمینه در توالی پپتیدهای مورد مطالعه با استفاده از نرم­افزار MUSCLE  اقدام به همردیفی 50 توالی بدست آمده گردید. 5 پپتید که طولی کمتر از 14 اسیدآمینه داشتند مورد همردیفی قرار نگرفتند.  نتیجه حاصله به Mview ارسال شد و نتیجه به صورت فایل تصویری ارائه گردید.

 

جدول 1- مشخصات پپتیدهای ضد سرطان گیاهی مورد آنالیز

 

APD ID

Name/Class

Sequence

1

AP00236

Pyrularia thionin

KSCCRNTWARNCYNVCRLPGTISREICAKKCDCKIISGTTCPSDYPK

2

AP00532

Lunatusin (plants, ZZHp, BWQ)

KTCENLADTFRGPCFATSNC

3

AP00553

Sesquin (defensins, plants, ZZHp; BWQ)

KTCENLADTY

4

AP00984

TPP3 (defensins; 4S=S; UCSS1a; plants; BBMm)

QICKAPSQTFPGLCFMDSSCRKYCIKEKFTGGHCSKLQRKCLCTKPC

5

AP01026

Varv peptide A (Varv A, kalata S; cyclotides; plants; XXC; 3S=S, UCBB1b; )

GLPVCGETCVGGTCNTPGCSCSWPVCTRN

6

AP01031

Varv peptide F (Varv F, cyclotides; plants; XXC; 3S=S, UCBB1b; plants)

GVPICGETCTLGTCYTAGCSCSWPVCTRN

7

AP01036

Cycloviolacin O2 (CyO2; cyclotides; plants; XXC; 3S=S, UCBB1b; ZZP)

GIPCGESCVWIPCISSAIGCSCKSKVCYRN

8

AP01121

Vibi E (plant cyclotides; plants; 3S=S, UCBB1b; XXC)

GIPCAESCVWIPCTVTALIGCGCSNKVCYN

9

AP01123

Vibi G (plant cyclotides; plants;3S=S, UCBB1b; XXC)

GTFPCGESCVFIPCLTSAIGCSCKSKVCYKN

10

AP01124

Vibi H (plant cyclotides; plants; 3S=S, UCBB1b; XXC)

GLLPCAESCVYIPCLTTVIGCSCKSKVCYKN

11

AP01277

Viscotoxin A3 (VtA3, thionins; UCSS1a; plants, BBMmMOA; 3S=S)

KSCCPNTTGRNIYNACRLTGAPRPTCAKLSGCKIISGSTCPSDYPK

12

AP01278

Viscotoxin 1-PS (Vt1-PS, thionins; UCSS1a; 3S=S, plants)

KSCCPNTTGRNIYNTCRFGGGSREVCARISGCKIISASTCPSDYPK

13

AP01279

Viscotoxin A1 (VtA1, thionins; UCSS1a; 3S=S, plants)

KSCCPNTTGRNIYNTCRLTGSSRETCAKLSGCKIISASTCPSNYPK

14

AP01280

Viscotoxin C (Viscotoxin C1, VtC1, thionins; UCSS1a; 3S=S, plants)

KSCCPNTTGRNIYNTCRFAGGSRERCAKLSGCKIISASTCPSDYPK

15

AP01281

Viscotoxin A2 (VtA2, thionins; UCSS1a; 3S=S, plants)

KSCCPNTTGRNIYNTCRFGGGSRQVCASLSGCKIISASTCPSDYPK

16

AP01282

Viscotoxin B (VtB, thionins; UCSS1a; 3S=S, plants)

KSCCPNTTGRNIYNTCRLGGGSRERCASLSGCKIISASTCPSDYPK

17

AP01284

Viscotoxin B2 (VtB2, thionins; UCSS1a; 3S=S, plants)

KSCCKNTTGRNIYNTCRFAGGSRERCAKLSGCKIISASTCPSDYPK

18

AP01342

Cn-AMP1 (C. nucifera antimicrobial peptide 1, plants)

SVAGRAQGM

19

AP01343

Cn-AMP2 (C. nucifera antimicrobial peptide 2, plants)

TESYFVFSVGM

20

AP01774

Cliotide T1 (cT1; cyclotides; XXC; 3S=S, UCBB1b; Fabaceae, plants; Other possible AMPs? Cliotide T5, Cliotide T6, Cliotide T8, Cliotide T9, Cliotide T11)

GIPCGESCVFIPCITGAIGCSCKSKVCYRN

21

AP01775

Cliotide T2 (cT2; cyclotides; XXC; 3S=S, UCBB1b; Fabaceae, plants; Others: cT5, cT6, cT7, cT8, cT9, cT10, cT11, cT12)

GEFLKCGESCVQGECYTPGCSCDWPICKKN

22

AP01776

Cliotide T3 (cT3; cyclotides; XXC; 3S=S, UCBB1b; Fabaceae, plants)

GLPTCGETCTLGTCYVPDCSCSWPICMKN

23

AP01777

Cliotide T4 (cT4; cyclotides; XXC; 3S=S, UCBB1b; Fabaceae, plants)

GIPCGESCVFIPCITAAIGCSCKSKVCYRN

24

AP01784

Vaby A (cyclotides; plants; 3S=S, UCBB1b; XXC; other AMPs?: Vaby B; VabyC; and VabyE)

GLPVCGETCAGGTCNTPGCSCSWPICTRN

25

AP01785

Vaby D (cyclotides; plants; 3S=S; XXC, UCBB1b;)

GLPVCGETCFGGTCNTPGCTCDPWPVCTRN

26

AP01805

Cr-ACP1 (C. revoluta anticancer peptide 1, plants)

AWKLFDDGV

27

AP01806

Viba 15 (cyclotides; plants; 3S=S, UCBB1b; XXC)

GLPVCGETCVGGTCNTPGCACSWPVCTRN

28

AP01807

Viba17 (cyclotides; plants; 3S=S, UCBB1b; XXC)

GLPVCGETCVGGTCNTPGCGCSWPVCTRN

29

AP01808

Viphi A (cyclotides; plants; 3S=S, UCBB1b; XXC)

GSIPCGESCVFIPCISSVIGCACKSKVCYKN

30

AP01809

Viphi D (cyclotides; plants; 3S=S, UCBB1b; XXC)

GIPCGESCVFIPCISSVIGCSCSSKVCYRN

31

AP01810

Viphi E (cyclotides; plants; 3S=S, UCBB1b; XXC)

GSIPCGESCVFIPCISAVIGCSCSNKVCYKN

32

AP01811

Viphi F (cyclotides; plants; 3S=S, UCBB1b; XXC)

GSIPCGESCVFIPCISAIIGCSCSSKVCYKN

33

AP01812

Viphi G (cyclotides; plants; 3S=S, UCBB1b; XXC)

GSIPCEGSCVFIPCISAIIGCSCSNKVCYKN

34

AP01813

Mram 8 (cyclotides; plants; 3S=S, UCBB1b; XXC)

GIPCGESCVFIPCLTSAIDCSCKSKVCYRN

35

AP01983

Psyle A (cyclotides; plants; 3S=S, UCBB1b; XXC. Other AMPs? psyle B, D, F )

GIACGESCVFLGCFIPGCSCKSKVCYFN

36

AP01984

Psyle E (cyclotides; plants; 3S=S, UCBB1b; XXC)

GVIPCGESCVFIPCISSVLGCSCKNKVCYRD 

37

AP01985

Psyle C (uncyclotides; UCSS1a; 3S=S, plants)

KLCGETCFKFKCYTPGCSCSYPFCK 

38

AP01986

hybrid peptide of melittin and protamine.

GDACGETCFTGICFTAGCSCNPWPTCTRN

39

AP01987

ChaC2 (chassatide C2, cyclotides; plants; 3S=S, UCBB1b; XXC; Variants: chaC2A, XXO)

GIPCAESCVWIPPCTITALMGCSCKNNVCYNN 

40

AP01988

ChaC4 (chassatide C4, cyclotides; plants; 3S=S, UCBB1b; XXC)

GASCGETCFTGICFTAGCSCNPWPTCTRN 

41

AP01989

ChaC7 (chassatide C7, uncyclotides; UCSS1a; 3S=S, plants)

IPCGESCVWIPCITAIAGCSCKNKVCYT 

42

AP01990

ChaC8 (chassatide C8, uncyclotides; UCSS1a; 3S=S, plants)

AIPCGESCVWIPCISTVIGCSCSNKVCYR 

43

AP01991

ChaC10 (chassatide C10, cyclotides; plants; 3S=S, UCBB1b; XXC)

GEYCGESCYLIPCFTPGCYCVSRQCVNKN 

44

AP01992

ChaC11 (chassatide C11, uncyclotides; UCSS1a; 3S=S, plants. Variants: chaC11A, XXO)

IPCGESCVWIPCISGMFGCSCKDKVCYS 

45

AP02325

Cliotide T7 (CT7; cyclotides; XXC; 3S=S, UCBB1b; Fabaceae, plants)

GIPCGESCVFIPCTVTALLGCSCKDKVCYKN 

46

AP02326

Cliotide T10 (CT10; cyclotides; XXC; 3S=S, UCBB1b; Fabaceae, plants)

GVPCAESCVWIPCTVTALLGCSCKDKVCYLN 

47

AP02327

Cliotide T12 (CT12; cyclotides; XXC; 3S=S, UCBB1b; Fabaceae, plants)

GIPCGESCVYIPCTVTALLGCSCKDKVCYKN 

48

AP02328

Cliotide T19 (CT19; cyclotides; XXC; 3S=S, UCBB1b; Fabaceae, plants)

GSVIKCGESCLLGKCYTPGCTCSRPICKKD 

49

AP02329

Lunasin (plants)

SKWQHQQDSCRKQLQGVNLTPCEKHIMEKIQGRGDDDDDDDDD 

50

AP02332

PaDef (P. americana defensin; plants; UCSS1a; 4S=S)

CETPSKHFNGLCIRSSNCASVCHGEHFTDGRCQGVRRRCMCLKPC 

51

AP02340

Cyclosaplin (cyclic peptides; plants; XXC, UCBB1a)

RLGDGCTR 

52

AP02657

Vigno 5 (cyclotides, plants; 3S=S, XXC; UCBB1b. More AMPs? Vigno 1-4, 6-10)

GLPLCGETCVGGTCNTPGCSCGWPVCVRN 

53

AP02659

DC1 (dissusa cyclotide 1, plants; 3S=S, XXC; UCBB1b)

GAFLKCGESCVYLPCLTTVVGCSCQNSVCYRD 

54

AP02660

DC2 (dissusa cyclotide 2, plants; 3S=S, XXC; UCBB1b)

GAVPCGETCVYLPCITPDIGCSCQNKVCYRD 

55

AP02661

DC3 (dissusa cyclotide 3, plants; 3S=S, XXC; UCBB1b)

GTSCGETCVLLPCLSSVLGCTCQNKRCYKD 

 


نتایج و بحث

Santalaceae

Solanaceae

نتایج بررسی جامع آماری 55 پپتید گیاهی دارای اثرات ضد­سرطانی اثبات شده نشان داد که از نظر تاکسونومی اغلب پپتیدها متعلق به رده Malpighiales بودند. رده Malpighiales از بزرگترین رده­های گیاهان گلدار می­باشد که 8/7 درصد کل دولپه­ای­ها را از بید تا بنفشه و کاکائو شامل می­شود. بعد از این رده، رده­های Gentianales، Fabales و Santalales در رتبه­های بعدی قرارداشتند. همچنین راسته Violaceae (بنفشه) بیشترین سهم را در برخورداری از پپتیدهای ضد­سرطان به خود اختصاص داد (شکل 1).

 

 

 

 

شکل 1- پراکندگی حضور پپتیدهای گیاهی در بین راسته­های مختلف گیاهان.

قابل­توجه اینکه همه قسمت­های بنفشه­ها (ریشه، ساقه، برگ، گل و دانه) دارای اثر ضدسرطانی بودند. راسته­های Rubiaceae، Fabaceae  و Santalaceae در رتبه­های بعدی قرار داشتند. انواع نخود و لوبیا، Chassalia chartacea ، برخی انواع دارواش، قهوه وحشی، آب نارگیل سبز، میوه آووکادو و Hedyotis diffusa(گیاه دارویی چینی) قادر به مهار انواع تومور و سرطان بودند.

سیکلوپپتیدهای گیاهی را می­توان به دو گروه عمده تقسیم کرد. گروه اول سیکلوپپتیدهایی که کمتر از 14 اسیدآمینه دارند و بند دی­سولفیدی نیز ندارند. این گروه از پپتید­ها در خانواده­های متعلق به راسته­های Caryophyllaceae و Rhamnaceae فراوان­اند. ظاهراً پپتیدهای ردیف­های 8، 18، 19، 26 و 51 از این نوع پپتیدها هستند (جدول 1). گروه دیگر سیکلوپپتیدها شامل سیکلوتیدهای اخیراً کشف شده­ای هستند که متعلق به خانواده بزرگی از مینی­پروتیین­ها می­باشند. 28 الی 37 اسید­آمینه با پیوندهای دی­سولفیدی دارند و مانند پروتیین­های درشت به ساختار سوم نیز می­روند. سیکلوتیدها بصورت قابل­ملاحظه­ای پایدارند و در مقابل دناتوره شدن دمایی، شیمیایی و تیمارهای آنزیمی مقاومند. سیکلوتیدها در گیاهان راسته­های Rubiaceae، Violaceae و Cucurbitaceae  به­فراوانی یافت می­شوند و Violaceae تنها راسته­ای است که همه گونه­های آن و بویژه جنس Viola دارای پپتیدهای ضدسرطان می­باشند. از برخی گیاهان دیگر مثل پاپاور Papaver  و
Viscum album L. پپتیدهای خطی با خاصیت ضد­تومور جداشده­است (16). با توجه به اهمیت لزوم استفاده از پپتیدهای پایدار با نیمه­عمر طولانی­تر، ویژگی­های پپتیدهای حلقوی گیاهی و تمرکز روی آنها می­تواند مفید باشد.

تقریبا 44 درصد پپتیدها طولی در بازه 25 الی 30 اسیدآمینه داشتند (شکل  2). وزن مولکولی میانگین پپتیدهای مورد مطالعه (ضد سرطان) در حدود 3 کیلودالتون می­باشد. ولی پپتیدهایی با حدود 50 اسیدآمینه هم در زمره پپتیدهای ضدسرطان گیاهی قرار گرفته­اند (10). اغلب پپتیدهای ضد­میکروب گیاهی وزنی در حدود 2 الی 10 کیلودالتون دارند.

شکل 3 فراوانی حضور اسید­آمینه­های متفاوت را در توالی پپتیدهای ضدسرطان نشان می­دهد. هر اسید­آمینه­ ویژگی­های خاصی دارد که به زنجیره جانبی آن مربوط است و منجر به انحصاری بودن نقش هر اسید­آمینه در ساختار پروتیین می­گردد. هیستیدین و متیونین کمترین فراوانی را در بین اسیدآمینه­های پپتیدها داشتند. سیستئین، سرین و گلیسین فراوانترین اسید­آمینه­ها بودند (شکل 3). بسیاری از پپتیدهای زیست فعال با توالی اسیدآمینه­های منحصر به فرد خود در یکی از سه گروه غنی از پرولین، غنی از سیستئین و یا دارای آرژینین/ لیزین قرار می­گیرند.

 

شکل 2- تراکم (Density) پپتیدها بر اساس تعداد اسید­های­آمینه (Length) در هر پپتید. بیشترین فراوانی مربوط به پپتیدهای با طول 25 الی 30 اسیدآمینه است.

شکل 3- فراوانی اسیدهای­آمینه (طبق سیستم نامگزاری یک حرفی) در ترکیب پپتیدهای ضد سرطان گیاهی مورد مطالعه.

 

نتیجه تجزیه و تحلیل فراوانی اسیدآمینه­های پپتیدهای ضدسرطان گیاهی نشان می­دهد ظاهراً این پپتیدها به گروه دوم تعلق دارند. پپتیدهای لیزکننده یک گروه از پپتیدها هستند که سایت­های هدف اولیه خود را بر روی غشاء سلولی قرار می­دهند و فعالیت­های ضد­باکتری قوی و ضد­سرطان نشان می­دهند. در پپتیدهای لیزکننده دارای محتوای آرژینین و لیزین بالا، این دو اسید­آمینه که نقش کلیدی اساسی در پپتید دارند، به شدت به فعالیت زیستی پپتیدها و تخریب غشاء کمک می­کنند. با این حال، یک اسید­آمینه اساسی دیگر، هیستیدین است که در پپتیدهای زیست فعال به سختی یافت می­شود. تا کنون فقط دو مورد از پپتیدهای ضد­میکروبی غنی از هیستیدین به نام­های هیستادین و کلاوانین معرفی شده­اند (26).  هیستیدین یک اسیدآمینه قطبی است که در تشکیل پیوند هیدروژنی به­عنوان دهنده یا گیرنده­ پروتون شرکت می­کند. در پروژه­های تحقیقاتی متفاوتی که دانشمندان طی آنها درصدد سرکوب رشد سلول­های سرطانی بودند با جایگزین کردن هیستیدین به جای لیزین، موفق به افزایش فعالیت پپتید در محیط­های اسیدی شدند (17; 26; 27). در تومورهای سفت اسیدیته برون­سلولی کاهش ولی اسیدیته درون­سلولی افزایش می­یابد (5). پپتیدهای لیز­کننده­ای که با تاثیر بر غشاءسلولی اقدام به انهدام سلول سرطانی می­کنند باید قادر به فعالیت در محیط اسیدی باشند ولی پپتیدهایی که مکانیسم­های درون سلولی را برای انهدام به خدمت می­گیرند باید بتوانند در محیط با اسیدیته بالاتر عمل نمایند. به نظر می­رسد دلیل فراوانی کم هیستیدین در پپتیدهای ضد سرطان گیاهی مکانیسم عمل درون سلولی آنها باشد. ممکن است اهداف درون سلولی پپتیدهای مورد نظر،  DNAو یا چاپرونین­ها باشند (30).  

متیونین یک اسیدآمینه هیدروفوب است و ترجیح می­دهد در هسته­های هیدروفوب پروتیین دفن شود. همچنین زنجیره جانبی متیونین نسبتاً غیر­واکنشی است و بنابراین به ندرت به طور­مستقیم در عملکرد پروتیین دخالت دارد. متیونین بر خلاف اسیدآمینه آلیفاتیک، یک اتم گوگرد دارد که می­تواند در اتصال به اتم­ها مانند فلزات دخیل باشد. درحالیکه اتم گوگرد سیستئین به یک اتم هیدروژن متصل­است و آن­را کاملاً واکنش­گر نموده است. در پپتیدهای حاضر دخالت سیستئین­ها در شکل­دهی به پل­های دی­سولفیدی بوضوح مشاهده می­شود (شکل 10)، ولی گوگرد متیونین به یک گروه متیل متصل است و این بدان معنی­است که نقش­هایی که متیونین می­تواند در عملکرد پروتیین بازی کند، بسیار محدود است. این موضوع می­تواند دلیل فراوانی کم متیونین در توالی پپتیدهای ضدسرطان باشد (3). اغلب پپتیدهای لیز­کننده با ایجاد تغییرات در غشاء سلول­ها و ایجاد منفذ به سلول وارد می­شوند و از این طریق موجب مرگ سلول­ها می­شوند. ولی Axelsen تغییرات در رونویسی چندین ژن میکروارگانیسم­های تیمار شده باcecropin A  در غلظت­های کمتر از نفوذکننده به سلول را گزارش و نتیجه­گیری کرد که قبل از نفوذپذیری به غشاء، اثرات متابولیک سیستمیک اتفاق می­افتد (11). این کار پیشنهاد کرد که تغییرات حتی در غلظت­هایی که  باعث نفوذپذیری نمی­شوند، رخ می­دهد. همچنین نتایج لی و وانگ نیز حاکی از بالا بودن سهم اسیدآمینه لیزین، گلیسین و لوسین در ترکیب پپتیدهای ضدسرطان است (15). گلیسین یک اسیدآمینه هیدروفیل است و زنجیره جانبی ندارد. اغلب در سطح پروتیین­ها و در مناطق درون حلقه یا کویل (بدون ساختار ثانویه) یافت می­شود. حضور گلیسین منجر به انعطاف­پذیری بالا در ساختار پلی­پپتیدها در این مناطق منجر می­شود. بنابراین فراوانی بالای آن در پپتید­های ضدسرطان می‍تواند در ارتباط با این ویژگی گلیسین باشد. حدود 5/85 درصد کل پپتیدها شامل 20 الی 40 درصد از اسیدآمینه­های هیدروفوب بودند (شکل4).

 

شکل 4- فراوانی پپتیدهای ضد­سرطان گیاهی مورد مطالعه براساس دارابودن تعداد اسیدهای­آمینه هیدروفوب (آب­گریز). اغلب پپتیدها دارای 20 الی 40 اسیدآمینه آبگریز هستند.

 

91 درصد پپتیدها کمتر از 10 اسیدآمینه اسیدی (شکل 5) و 71 درصد پپتیدها کمتر از 10 اسیدآمینه بازی داشتند. تقریباً 96 درصد پپتیدها بیش از 40 درصد اسیدآمینه خنثی داشتند. اغلب پپتیدهای ضدمیکروبی گیاهی بازی هستند که نتایج سایر محققین نیز تاییدی بر این مسئله است (10; 28).

 

شکل 5- فراوانی پپتیدهای ضد­سرطان گیاهی مورد مطالعه براساس دارابودن تعداد اسیدهای­آمینه اسیدی. اغلب پپتیدها کمتر از 5 اسیدآمینه اسیدی دارند.

 

 

اولین گام برای ورود پپتید به سلول (اگر چه به طور خاص برای جذب سلولی مورد نیاز نیست)، برهم­کنش الکترواستاتیک پپتید با بارهای منفی پروتئوگلیکان­ها و فسفولیپید­های سطح سلول است. علاوه بر آن، به­ویژه در مورد پپتیدهای دوگانه­دوست اتصال به غشاء و ورود نیز مهم است که می­تواند منجر به مسیرهای اندوسیتوزی یا انتقال مستقیم شود. برهم­کنش با اجزای غشاء پلاسمایی، به شدت توسط تعداد بار مثبت و تراکم آن، پیوندهای هیدروژنی، اندازه و ساختار ثانویه پپتیدها کنترل می­شود (2). بار مثبت پپتید به حضور اسید­آمینه آرژینین و لیزین وابسته است. وجود حدود 7 الی 15 اسیدآمینه آرژینین در این پپتیدها به عبور از غشاء سلولی کمک می­کند. آبدوستی پپتید بیش از همه به حضور اسیدآمینه تریپتوفان و لیزین در ترادف پپتید وابسته است.

با استفاده از چنین اطلاعاتی در مورد ساختار پپتیدهای ضد­سرطان دانشمندان قادر به دستکاری و تولید پپتیدهای جدید ضد­سرطان خواهند شد. به­عنوان مثال با افزودن اسید­آمینه­های باردار مثبت به انتهای آمینی پپتیدS1 انتخاب­گری و ضد­سرطانی آن­را در موش افزایش دادند (4). شارژ خالص 76 درصد پپتیدها بین 2- الی 2 بود (شکل6).

 

شکل6- فراوانی پپتیدهای ضد­سرطان گیاهی مورد مطالعه براساس شارژ خالص آنها. اغلب پپتیدها شارژ خالص در بازه 2- الی 2 دارند.

 

64 درصد پپتیدها اندکس بومن کمتر از 1 داشتند (شکل 7). پایین بودن این اندکس نشانگر هیدروفوبیسیتی بالای این پپتیدها و افزایش احتمال برهم­کنش آنها با سایر پروتیین­هاست.

 

 

شکل 7- فراوانی پپتیدهای ضد­سرطان گیاهی مورد مطالعه براساس اندیکس بومن آنها. اغلب پپتیدها اندیکس بومن کمتر از 1 دارند.

 

همچنین مهمترین ساختار سه­بعدی شناخته شده برای پپتیدهای ضد­سرطان گیاهی حضور 3 پل دی­سولفیدی بود. نتایج حاصل از همردیفی و جستجوی اسیدآمینه­های حفاظت­شده نیز این مورد را تایید می­نماید (شکل 7). حضور 6 اسید آمینه سیستئین در 70 درصد پپتیدها، نشان دهنده اهمیت تشکیل 3 پل دی­سولفیدی برای قابلیت تبدیل­شدن یک پپتید به پپتید ضدسرطان می­باشد. بیشتر پپتیدهای ضدمیکروب گیاهی 4،6،8 و یا 12 اسیدآمینه سیستئین دارند که می­توانند پل­های دی­سولفیدی تشکیل دهند. حضور این ساختار به پایداری ساختاری و ترمودینامیکی پپتید کمک می­کند (10). ساختار سه­بعدی تعدادی از پپتیدها هنوز شناسایی نشده بود با این وجود پپتیدهایی با ساختار ترکیبی مارپیچ-صفحه نیز در بین آنها حضور داشتند (شکل 8). لی و وانگ (2016) گزارش کردند که اغلب پپتیدهای ضدسرطان ساختار آلفا­ هلیکس و یا صفحه­ بتا دارند (15). طبق بررسی­های انجام شده این پپتیدها می­توانند هم ساختار آلفا هلیکس و هم ساختار صفحه بتا داشته باشند و ارتباط خاصی بین ساختار ثانویه پپتید و توان آن برای ورود به غشاء یافت­نشده است. پلی­مورفیسم ساختار ثانویه پپتیدها با این واقعیت که پپتید­ها باید با محیط­های مختلف چربی ارتباط برقرار کنند و از این رو برای سازش با آن محیط­ها باید سازگاری پیدا کنند، همبستگی دارد (2). اغلب پپتیدهای ضدمیکروب گیاهی از ساختار 𝛽𝛼𝛽𝛽 پیروی می­کنند که این وضعیت در تعداد کمی از پپتیدهای ضدسرطان دیده می­شود (1و 10).

 

Combine Helix

 and Beta

Structure is

predicted

 
   

 

 

 

 

 

 


شکل8- فراوانی انواع ساختارهای سه بعدی پپتیدهای ضد سرطان گیاهی مورد مطالعه. تقریباً نیمی از پپتیدها دارای پل­های دی­سولفیدی می­باشند.

 

 

51 درصد پپتیدها فقط خاصیت ضد­سرطانی داشتند ولی 49 درصد علاوه بر اثر ضد­سرطانی، اثرات ضد­ویروس، میکروب، قارچ و سلول­های پستانداران را نیز دارا بودند (شکل 9).

 

 

 

 

 

 

 

 

شکل 9- فراوانی پپتیدهای ضد­سرطان گیاهی مورد مطالعه براساس اثر آنها بر سایر سلول­های زنده. بیش از نیمی از پپتیدها فقط اثر ضدسرطانی دارند ولی سایر پپتیدها بیش از دو نوع ارگانیسم زنده (پروکاریوتی و یا یوکاریوتی) را از بین می برند..

 

هرچند که مبنای انتخاب اولیه این پپتیدها اثرات ضدسرطانی آنها بود، ولی جالب است که این اثر سمی و کشندگی بر سلول زنده منحصر به سلول­های سرطانی نیست و سایر ارگانیسم­ها و انواع سلول­ها نیز تحت تاثیر این پپتیدها مورد آسیب و مرگ سلولی قرار می­گیرند. شمار زیادی از پپتیدهایی که به­عنوان ضد­میکروب شناخته شده­اند اثرات ضد­سرطانی نیز دارند مخصوصاً با ویژگی کاتیونی و آمفی­پاتیک بودن (6 و 20). به­نظر می­رسد هدف اولیه گیاهان جهت بیوسنتز و انباشتگی چنین پپتیدهایی در کنار متابولیت­های ثانویه، ایجاد ارتباط و برهم­کنش مناسب گیاه با سایر ارگانیسم­ها باشد.

 

 

شکل10- نتیجه همردیفی و جستجوی اسیدآمینه­های حفاظت­شده در بین پپتیدهای ضدسرطان گیاهی.

 

پپتیدهای ضد­میکروبی جزء فراگیر و تکاملی باستانی از دفاع میزبان ذاتی هستند که تقریباً در همه اشکال حیات وجود دارند. شواهد سال­های اخیر نشان می­دهد که مکانیسم عمل پپتیدهای ضد­میکروبی در محدود کردن تکثیر سلول­های سرطانی نیز موثر هستند. بنابراین علاقه­مندی زیادی به توجه به آن­ها به عنوان عوامل جدید بیولوژیک و ایمنوتراپی در برابر سرطان­های بوجود آمده است (21).

داروهای مورد استفاده در طب چینی مانند
Foeniculum vulgare از Apiaceae از جمله مثال­های موفق پپتیدهای ضد­سرطان گیاهی هستند که ترکیب ضد­میکروبی آنیونی می­باشد (9). همچنین بررسی بازه زمانی کشف و معرفی پپتیدها نشان داد که اغلب پپتیدها در سال­های 2011 و 2012 کشف شده­­اند.

نتیجه­گیری

با توجه به این نکته که اغلب نرم افزارها و ابزارهای تجزیه و تحلیل آماری موجود قادر به جمع­بندی داده­­های وسیع نیستند، استفاده از محیط نرم­افزار  Rنویسندگان این مقاله را قادر ساخت تا بتوانند به اطلاعات طبقه­بندی شده­ای از ویژگی­های کیفی پپتیدهای ضدسرطان موجود گیاهی برسند. نتایج بررسی حاضر از جمله طول 25 الی 30 اسیدآمینه، فراوانی بالای سیستئین، سرین و گلیسین، قابلیت بالا در برهم­کنش با سایر پروتیین­ها و حضور حداقل 3 بند دی­سولفیدی، حاکی است که می­توان از آن به عنوان مرحله امیدبخش و موثر تحقیقاتی با آینده­ای روشن یاد کرد. به­نظر میرسد پپتیدهای گیاهی به روش متفاوتی از پپتیدهای لیزکننده، سلول سرطانی را نابود می کنند. فراوانی اسیدآمینه­های خنثی، فراوانی کم هیستیدین و عدم وابستگی فعالیت پپتید به اسیدیته، ساختارهای متنوع ثانویه و بالا بودن احتمال برهم­کنش با سایر پروتیین­ها می­تواند شاهدی براین مدعا باشد که پپتیدهای ضدسرطان گیاهی پس از ورود به سلول و برهم­کنش با برخی بیومولکول­ها (احتمالا چاپرونین­ها، پروتیین­ها و شاید DNA ) مقدمات مرگ و نابودی سلول سرطانی را فراهم می­آورند. روند رو به رشد سرطان و محدودیت­های مختلف در درمان متعارف شامل هزینه­های بالا و سمیت بالای داروهای ضد­سرطان فعلی یک چالش جدی برای بشریت محسوب می­شود. محققان برای طراحی و توسعه یک جایگزین مناسب، سازگار با محیط­زیست، که استحصال و استعمال آن مقرون به­صرفه باشد به فیتومولکول­ها رسیده­اند. در این مسیر سبز انتظار می­رود یافتن مولکول معجزه­گر انقلابی در درمان سرطان در دهه آینده ایجاد کند. زیست تخریب­پذیری بالا و سازگاری با سیستم­های زنده باعث افزایش کارایی این فیتومولکول­ها در درمان سرطان می­شود. این مقاله ویژگی­های عمومی پپتیدهای گیاهی را آشکار نموده و راه را برای مطالعات آینده در راستای ایجاد پپتیدهای نوترکیب با ویژگی­های چند پپتید ارایه­شده در این مقاله، باز نموده است. عدم ارتباط مستقیم بین ساختار ثانویه و عملکرد پپتیدهای ضد سرطان نیز موضوع قابل توجهی است که دست طراحان دارو را در این زمینه باز می گزارد. برنامه­های کاربردی برای طراحی و آزمایشات بیوتکنولوژیک تولید و استخراج، آزمودن در مرحله آزمایشگاهی، پری­کلینیکی و مدل حیوانی و انسان، این پپتیدها تلاش هماهنگ دانشمندان همه علوم مرتبط را می­طلبد.

1- Andres E, Dimarcq J. 2004. Cationic antimicrobial peptides: update of clinical development. Journal of internal medicine 255:519-20

2- Bechara C, Sagan S. 2013. Cell‐penetrating peptides: 20 years later, where do we stand? FEBS letters 587:1693-702

3- Brosnan JT, Brosnan ME, Bertolo RF, Brunton JA. 2007. Methionine: a metabolically unique amino acid. Livestock Science 112:2-7

4- Chu H-L, Yip B-S, Chen K-H, Yu H-Y, Chih Y-H, et al. 2015. Novel antimicrobial peptides with high anticancer activity and selectivity. PLoS One 10:e0126390

5- Damaghi M, Wojtkowiak JW, Gillies RJ. 2013. pH sensing and regulation in cancer. Frontiers in physiology 4:370

6- Felício MR, Silva ON, Gonçalves S, Santos NC, Franco OL. 2017. Peptides with dual antimicrobial and anticancer activities. Frontiers in chemistry 5:5

7- Fosgerau K, Hoffmann T. 2015. Peptide therapeutics: current status and future directions. Drug discovery today 20:122-8

8- Fridlender M, Kapulnik Y, Koltai H. 2015. Plant derived substances with anti-cancer activity: from folklore to practice. Frontiers in plant science 6:799

9- Galdiero S, Gomes PA. 2017. Peptide-Based Drugs and Drug Delivery Systems. Multidisciplinary Digital Publishing Institute

10- Guzmán-Rodríguez JJ, Ochoa-Zarzosa A, López-Gómez R, López-Meza JE. 2015. Plant antimicrobial peptides as potential anticancer agents. BioMed research international 2015

11- Hong RW, Shchepetov M, Weiser JN, Axelsen PH. 2003. Transcriptional profile of the Escherichia coli response to the antimicrobial insect peptide cecropin A. Antimicrobial agents and chemotherapy 47:1-6

12- Hu C, Chen X, Zhao W, Chen Y, Huang Y. 2016. Design and modification of anticancer peptides. Drug Des 5:2169-0138.1000138

13- Iqbal J, Abbasi BA, Mahmood T, Kanwal S, Ali B, Khalil AT. 2017. Plant-derived anticancer agents: A green anticancer approach. Asian Pacific Journal of Tropical Biomedicine

14- Lau JL, Dunn MK. 2018. Therapeutic peptides: Historical perspectives, current development trends, and future directions. Bioorganic & medicinal chemistry 26:2700-7

15- Li F-M, Wang X-Q. 2016. Identifying anticancer peptides by using improved hybrid compositions. Scientific reports 6:33910

16- Ma X, Wu C, Wang W, Li X. 2006. Peptides from plants: a new source for antitumor drug research. Asian Journal of Traditional Medicines 1:85-90

17- Makovitzki A, Fink A, Shai Y. 2009. Suppression of human solid tumor growth in mice by intratumor and systemic inoculation of histidine-rich and pH-dependent host defense–like lytic peptides. Cancer research 69:3458-63

18- Marqus S, Pirogova E, Piva TJ. 2017. Evaluation of the use of therapeutic peptides for cancer treatment. Journal of biomedical science 24:21

19- Mir Mohammadrezaei F. 2015. The Role of chk2 in Response to DNA Damage in Cancer Cells. Journal of Genetic Resources 1:31-4

20- O'Brien-Simpson NM, Hoffmann R, Chia C, Wade JD. 2018. Antimicrobial and Anticancer Peptides. Frontiers in Chemistry 6:13

21- Roudi R, Syn NL, Roudbary M. 2017. Antimicrobial peptides as biologic and immunotherapeutic agents against cancer: A comprehensive overview. Frontiers in immunology 8:1320

22- Shandiz S, Ataollah S, Salehzadeh A, Ahmadzadeh M, Khalatbari K. 2017. Evaluation of cytotoxicity activity and NM23 gene expression in T47D breast cancer cell line treated with glycyrrhiza glabra extract. Journal of Genetic Resources 3:47-53

23- Shoombuatong W, Schaduangrat N, Nantasenamat C. 2018. Unraveling the bioactivity of anticancer peptides as deduced from machine learning. EXCLI journal 17:734

24- Studio R. 2012. RStudio: integrated development environment for R. RStudio Inc, Boston, Massachusetts:74

25- Teerasak E, Thongararm P, Roytrakul S, Meesuk L, Chumnanpuen P. 2016. Prediction of anticancer peptides against MCF-7 breast cancer cells from the peptidomes of Achatina fulica mucus fractions. Computational and structural biotechnology journal 14:49-57

26- Tu Z, Volk M, Shah K, Clerkin K, Liang JF. 2009. Constructing bioactive peptides with pH-dependent activities. Peptides 30:1523-8

27- Tu Z, Young A, Murphy C, Liang JF. 2009. The pH sensitivity of histidine‐contain‐ing lytic peptides. Journal of peptide science: an official publication of the European Peptide Society 15:790-5

28- Tyagi A, Kapoor P, Kumar R, Chaudhary K, Gautam A, Raghava G. 2013. In silico models for designing and discovering novel anticancer peptides. Scientific reports 3:2984

29- Wang G, Li X, Wang Z. 2015. APD3: the antimicrobial peptide database as a tool for research and education. Nucleic acids research 44:D1087-D93

30- Wimley WC. 2010. Describing the mechanism of antimicrobial peptide action with the interfacial activity model. ACS chemical biology 5:905-17