نوع مقاله: مقاله پژوهشی

نویسندگان

1 دانشگاه اصفهان

2 عضو هیئت علمی/ دانشگاه اصفهان

3 عضو هیئت علمی/ دانشگاه علوم پزشکی

4 عضو هیئت علمی/ دانشگاه علوم پزشکی اراک

5 عضو هیئت علمی/دانشگاه اصفهان

چکیده

NSLTP (nonspecific lipid transfer protein) ها پروتئین ‌هایی گیاهی هستند که بر اساس وزن مولکولی به دو گروه nsLTP1 و nsLTP2 تقسیم بندی می ‌شوند. این پروتئین ها بسیار مقاوم هستند و علاوه بر پتانسیل حمل داروها می ‌توانند آن ‌ها را در برابر اکسیداسیون یا تجزیه شدن محافظت کنند. مولکول nsLTP2 گیاه برنج ، پروتئینی است که به دلیل توانایی ذاتی عبور از غشا و اتصال به ترکیبات استروئیدی (از جمله برخی ترکیبات داروئی) پتانسیل استفاده در سیستم تحویل داروئی را دارد. در این تحقیق با هدف افزایش خاصیت فلورسانس در ژن Iranian rice nsltp2 ( Oriza sativa)، جهش‌ های هدایت یافته مکانی ایجاد گردید. برای ایجاد جهش از تکنیک SOE-PCR (splicing by overlap extension-polymerase chain reaction) به منظور اعمال جهش (تبدیل کننده اسیدآمینه تیروزین شماره 45 به تریپتوفان (Y45W)) در ژن کد کننده nsLTP2 برنج استفاده شد. مطالعات انجام شده بر روی سایر ګونه های این مولکول حاکی از افزایش خاصیت فلورسانس در اثر ایجاد این نوع جهش می باشد. در مرحله بعد با تکثیر قطعات جهش یافته و تایید جهش ایجاد شده توسط سکوئنسینگ، محصول جهش یافته درون وکتور pET32-a کلون و پس از بیان در سویه بیانی BL21(DE3)pLYSs، پروتئین تغییر یافته فیوژن باHis-tag ، تخلیص و وجود این پروتئین با استفاده از وسترن بلات تایید گردید. امید می ‌رود در تحقیقات آتی از این پروتئین بتوان به عنوان یک انتقال دهنده داروئی به خصوص داروهای درمان سرطان استفاده نمود.

کلیدواژه‌ها

عنوان مقاله [English]

Site directed mutagenesis to produce mutant Iranian rice-NSLTP2 (Oriza sativa) protein that contains Y45Wmutation

نویسندگان [English]

  • azam ahmadi 1
  • Mehran Miroliaei 2
  • majid Motevali bashi 1
  • abdorahim sadeghi 3
  • hamid abtahi 4
  • zahra eslami 4
  • Kamran Ghaedi 5

1 Isfahan

2 University of isfahan

3 Faculty member/ arak medical university

4 Faculty member/ arak medical university

5 University of Isfahan

چکیده [English]

NSLTPs are plant proteins that are subdivided into nsLTP1(9kDa) and nsLTP2 (7kDa) according to the molecular weight. These highly stable proteins can protect drugs against oxidation or degradations. Rice NsLTP2 due to the inherent ability to cross biological membranes and bind to steroid compounds (including some pharmaceutical compounds) have potential application for use in drug delivery systems. After designing of mutagenic primers (contains a mutation of (Y45W)) the method of SOE-PCR (splicing by overlap extension-polymerase chain reaction) is used to site directed mutagenesis in the gene encoding the rice nsLTP2. Wild type nsLTP2 was cloned in to the PGEX6p2 vector. This wild type plasmid was used as a template for constructing the mutant fragment and designed mutant primers are used for amplification of mutant fragments. Mutant rice nsLTP2 are expressed in the pET32a vector in to the E.coli BL21(DE3) strain. After the amplification of the mutant fragments and confirmation of mutations generated by sequencing, the mutant constructs cloned into the pET32a vector and the fusion mutant protein with a His-tag was purified by Ni-NTA Affinity chromatography column. The purpose of this study is Site directed mutagenesis to production the mutant Iranian rice-NSLTP2 (Oriza sativa) protein that contains Y45Wmutation. We hope that, in the future, these findings could contribute that this protein could be used to create biosensors or act as drug carriers.

کلیدواژه‌ها [English]

  • mutagenesis
  • SOE-PCR
  • Drug Delivery System

جهش زایی هدایت یافته مکانی به منظور تولید پروتئین جهش یافته Iranian rice-NSLTP2 (Oriza sativa) حاوی جهش Y45W

اعظم احمدی1، مهران میراولیائی1*، مجید متولی باشی1، عبدالرحیم صادقی2، حمید ابطحی2 و زهرا اسلامی راد2 

1 اصفهان، دانشگاه اصفهان، دانشکده علوم، گروه زیست شناسی، بخش سلولی و مولکولی

2 اراک، دانشگاه علوم پزشکی اراک، دانشکده پزشکی، مرکز تحقیقات پزشکی و مولکولی 

تاریخ دریافت: 2/12/91               تاریخ پذیرش: 14/5/92 

چکیده

NSLTP (nonspecific lipid transfer protein) ها پروتئینهای گیاهی هستند که بر اساس وزن مولکولی به دو گروه nsLTP1 و nsLTP2 تقسیم بندی می ‌شوند. این پروتئینها بسیار مقاومند و علاوه بر پتانسیل حمل داروها می ‌توانند آنها را در برابر اکسیداسیون یا تجزیه شدن محافظت کنند. nsLTP2 برنج پروتئینی است که به دلیل توانایی ذاتی عبور از غشاء و اتصال به ترکیبات استروئیدی (از جمله برخی ترکیبات داروئی) پتانسیل استفاده در سیستمهای تحویل دارو را دارد. در این تحقیق با هدف افزایش خاصیت فلورسانس در ژن Iranian rice nsltp2 ( Oriza sativa)، جهشهای هدایت یافته مکانی ایجاد گردید. برای ایجاد جهش از تکنیک SOE-PCR (splicing by overlap extension-polymerase chain reaction) در تبدیل اسیدآمینه تیروزین 45 به تریپتوفان (Y45W) ژن nsLTP2 استفاده شد. مطالعات انجام شده بر روی سایر گونه های این پروتئین حاکی از افزایش خاصیت فلورسانس در اثر ایجاد این نوع جهش است. در مرحله بعد با  تکثیر قطعات جهش یافته و تأیید جهش ایجاد شده توسط توالی یابی، محصول جهش یافته در وکتور pET32-a کلون و پس از بیان در سویه بیانی BL21(DE3)pLYSs، پروتئین تغییر یافته حاویHis-tag ، تخلیص و وجود پروتئین با استفاده از وسترن بلات تایید گردید. امید می ‌رود از این پروتئین بتوان به عنوان یک انتقال دهنده داروئی به خصوص داروهای درمان سرطان استفاده شود. 

واژه های کلیدی: nsLTP2، جهش زایی، SOE-PCR، سیستم تحویل داروئی 

* نویسنده مسئول، تلفن:03137932475 پست الکترونیکی: m.miroliaei@sci.ui.ac.ir

مقدمه

 

LTP ها پروتئینهای گیاهی مسئول انتقال فسفولیپیدها و سایر اسیدهای چرب بین غشاهای سلول هستند (17و22) که براساس وزن مولکولی به دو گروه1 و 2 طبقه­ بندی می شوند. اسکلت پلی­پپتیدی آنها شامل 4 مارپیچ است که توسط لوپهای منعطف به هم متصل هستند. پایداری این پروتئینهای قلیایی کوچک حاصل 4 پیوند دی­ سولفیدی است که سبب استحکام ساختار می ­شوند (14). سیستئین ­های تشکیل دهنده این پیوندهای دی سولفیدی در همه گونه های گیاهی حفاظت­ شده هستند (19).

مولکول LTP2 برنج متشکل از 96 اسیدآمینه است که از این تعداد 27 اسید ­آمینه مربوط به سیگنال پپتیدی است که در انتهای آمین (N) آن قرار گرفته است (3). همانند سایر مولکولهای LTP، چهار باند دی ­سولفیدی برای تثبیت ساختار پروتئین ضروری می ­باشد (18). عملکرد این پروتئین مداخله در فرآیندهای فیزیولوژی گیاه شامل بیوسنتز لایه کوتین، پیام ­رسانی دفاعی (2)، مدیریت در شرایط استرس (8) و تنظیم بتااکسیداسیون اسیدهای چرب در گلی­ اکسیزوم است. به علاوه، این پروتئین دارای یکسری خواص منحصر ­به­ فرد از جمله ایجاد آلرژنی (10و24)، خواص ضد حشره­ای، ضد قارچی، مقاومت در برابر گرما و مواد دناتوره ­کننده، پایداری در برابر برخی از پروتئازها (13) و توانایی اتصال و انتقال یکسری ترکیبات خاص (4و7) می باشد.

 

mmrklavlvlavamvaacgggvvgvagagcnagqltvctgaiaggarptaaccsslraqqgcfcqfakdprygrvynspnarkavsscgalptch

شکل 1- نمایی از ساختار LTP2 در سایت PDB  (1L6H) و توالی 96 اسیدآمینه ای آن (http://upload.wikimedia.org/wikipedia /commons/1/1a/PDB_1L6H_EBI.jpg)

توانایی اتصال و انتقال ترکیبات از طریق حفره هیدروفوبیکی که قادر به پذیرش زنجیر آسیل است اعمال می شود. این پروتئین به دلیل توانایی اتصال  به طیف وسیعی از مولکولهای لیپیدی، پتانسیل استفاده در سیستم تحویل دارو را دارد (16و25).

امروزه اکثر سیستمهای تحویل داروی به دنبال افزایش کارآیی از طریق حفاظت ترکیبات داروئی در برابر شرایط محیطی و تجزیه شدن هستند. حاملین داروئی نه تنها باید با کارآیی بالا به دارو متصل شوند بلکه به منظور کاهش اثرات سمی دارو بر سلولها، باید دارو را در نزدیکی سلولهای هدف آزاد کنند. بر این اساس به منظور افزایش توانمندیهای این پروتئین در سیستمهای تحویل دارو لازم است در ساختار آن تغییراتی صورت پذیرد. پروژه حاضر به منظور ارتقای برخی توانمندی های زیستی این پروتئین با استفاده از تکنیک جهش زایی هدایت شده برخی ریشه های اسیدآمینه کلیدی در فعالیت زیستی آن را تغییر داده است.

جهش زایی آزمایشگاهی (mutagenesis In vitro) تکنیکی ارزشمند جهت مطالعه ساختار و عملکرد اسیدهای نوکلئیک و پروتئینها است. سه روش ایجاد جهش زایی هدایت یافته مکانی (SDM) وجود دارد که در روشهای جهش زایی به کمک PCR از پرایمرهای حاوی جهش برای سنتز توالی مورد نظر استفاده می شود. در برخی از تحقیقات با استفاده از ایجاد جهشهای نقطه ­ای در این پروتئین تغییراتی داده اند (4و15). در این مطالعه با استفاده از تکنیک SDM یا SOE-PCR (Splicing by by Overlap Extention-PCR) جهش Y45W در LTP2 گیاه برنج (Oryza sativa) انجام شده است.

مواد و روشها

بررسیهای بیوانفورماتیک: ساختار سه بعدی پروتئین rice ns-LTP2، قبل و بعد از اعمال جهش با کمک نرم افزار molegro virtual docker (MVD)، نسخه Trial، بررسی گردید.

ایجاد جهش Y45W  با استفاده از تکنیک SOE-PCR : پرایمرهای جهش زای  r1(5'-CGTAGCGCCCCCAGCGCGGGTCCTTG-3') و f1 (5'-CAAGGACCCGCGCTGGGGGCGCTACG-3') به منظور ایجاد جهش و دو پرایمر F-ltp (5'-CTGGGTACCGACGACGACGACAAGGCCGGTTGCAACGC-3') و R-ltp (5'-TAACTCGAGGTGGCAGGTGGGGAGGGC-3') به منظور کلون قطعات جهش یافته در وکتور pET32-a طراحی شدند. در انتهای 5' پرایمر F-ltpجایگاه برش آنزیم  KpnIو جایگاه برش انتروکیناز و سپس توالی ژن ltp از نوکلئوتید 79 تا کدون پایان قرار گرفت و در انتهای 5' پرایمر R-ltp جایگاه برش آنزیم XhoI قرار داده شد. به گونه ای که پس از تکثیر، این دو جایگاه آنزیمی XhoI و KpnI در دو طرف ژن جهش یافته قرار گیرند.

تکنیک SOE-PCR توسط سه نوع واکنش مجزا با دمای اتصال 59.3 درجه سانتی گراد به نحوی انجام گردید که در واکنش اول و دوم پرایمرهای F , rI و  fI , R به ترتیب قطعات 169 bp و  99 bpرا تولید کردند. سپس این قطعات به عنوان الگو برای تشکیل قطعه ای 243 bp با پرایمرهای F , R استفاده شدند.

با توجه به اینکه پرایمر F-ltp نسبت به R-ltp اندازه بزرگتری دارد برای جلوگیری از تکثیر ساختارهای ثانویه از موادی مثل DMSO و بتائین استفاده شد. اندازه قطعه نهایی حاصل از تکثیر توسط این دو پرایمر 243bp است.

توالی­یابی: به منظور تأیید ایجاد جهش­ محصولات PCR برای توالی ­یابی با دستگاه Applied Biosystem با واسطه شرکت سیناکلون به شرکت Source BioScience انگلستان فرستاده شد.

کلنینگ محصولات حاوی جهش درون وکتور
 
pET-32a :) هضم آنزیمی و الحاق: به منظور قرار دادن قطعات حاوی جهش در وکتور pET-32a ابتدا محصولات PCR و وکتور تحت اثر برش با آنزیمهای محدود­کننده  kpnxhoI قرار گرفتند. پس از ایجاد انتهاهای چسبنده در قطعه و وکتور برش­ خورده، وکتور و قطعهinsert  با نسبت مولی 1 به 3 با کمک آنزیم T4 (فرمنتاز) به هم متصل شدند.

ترانسفورماسیون وکتور نوترکیب به داخل باکتری
E. coli ( سویه( pLYSs : محلول ligation حاصل از مرحله قبل با روش ایجاد شوک حرارتی به سلولهای مستعد pLYSs  منتقل و سپس باکتری ها روی پلیت LB حاوی کلرامفنیکل (0.34µl/ml)، به مدت یک شبانه­ روز انکوبه شدند. به منظور تأیید صحت انجام ترانسفورماسیون بر روی کلنیهای تولید شده در مرحله قبل، کلنی PCR انجام شد.

بیان پروتئینهای نوترکیب در باکتریهای ترانسفورم شده: کلنیهای ترنسفورم شده نوترکیب به سلولهای مستعد pLYSs پس از کشت شبانه­ روزی در محیط LB براث حاوی آمپی سیلین (100µg/ml) و کلرامفنیکل (0.34µl/ml) در محیط القا کشت داده شدند. رسوبهای حاصل پس از القاء توسط IPTG  بر روی ژل 12 درصد SDS PAGE لود گردیدند.

تخلیص پروتئین از سلولهای بیان­کننده پروتئین جهش یافته و وسترن بلاتینگ: سلولهای بیان­ کننده پروتئینهای جهش یافته حاصل از مرحله قبل، پس از سانتریفیوژ و جداسازی رسوب توسط ستون  Ni (Ni-NTA, Qiagen) تخلیص و وجود آنها با وسترن بلات توسط آنتی بادی کونژوگه علیه His-Taq (Qiagen) تأیید گردید. در تکنیک وسترن بلاتینگ انجام شده در این مطالعه تنها یک نوع آنتی بادی (آنتی بادی کونژوگه با His-Taq) مورد استفاده قرار گرفت. نکته مهم در استفاده از این آنتی­ بادی اینکه برای رقیق نمودن آن به جای استفاده از بافر بلوکه­ کننده، از بافر TBS حاوی توئین با نسبت 1:1000 استفاده گردید.

جدول 1- مقایسه برخی خصوصیات نوع وحشی و نوع جهش یافته (Y45W)  در LTP2 توسط  MVD


نوع وحشی

نوع جهش یافته(Y45W)

حجم حفره (A°3)

36.352

30.696

سطح حفره (A°2)

84.48

78.02

انرژی اتصال (Kcal/ mol)

-4.427

-5.784

نتایج

بررسیهای انجام گرفته با نرم افزار  MVD  حاکی  از  عدم

تغییر در ساختار rice-ns LTP2 قبل و بعد از اعمال جهش بود. جدول 1 حاوی برخی از پارامترهای بررسی شده توسط این نرم افزار است.

اندازه قطعات حاصل از تکثیر پرایمرهای ذکر شده در تکنیک  SOE-PCR نشان­ دهنده صحت پرایمرهای طراحی شده می­ باشد.

 

 

شکل 2- قطعات جهش یافته برای تولید جهشهای  Y45Wبر روی ژل آکریل آمید 8 درصد: ستونهای 2 و 4 به ترتیب قطعات 99bp و  169bp(به ترتیب حاصل از تکثیر پرایمرهای  fI , R  و F , rI )، ستون 3 نشان­ دهنده قطعه 243bp جهش یافته Y45W حاصل از تکثیر قطعات ستونهای 2 و 4 به عنوان template است. ستونهای 1 و 5 مربوط به تکثیر قطعات با جهشهای دیگر است.

 

صحت حضور جهش Y45W در ژنLTP2  با تعیین توالی DNA تأیید گردید.

به منظور تأیید صحت انجام ترانسفورماسیون کلنیهای تولید شده، کلنی PCR انجام شد. محصول 243 جفت بازی حاصل از تکثیر کلنی حاوی پلاسمید نوترکیب، در شکل 3 نشان داده شده است.

 

شکل 3- کلنی PCR از کلنیهای ترسفورم شده روی ژل آگارز %1 : باند مشخص شده با فلش نشان ­دهنده محصول  PCR حاصل از تکثیر کلنی نوترکیب  با پرابمرهای F-ltp وR-ltp می­باشد.

پس از بیان پروتئینهای جهش­ یافته، رسوب سلولی حاصل سانتریفیوژ، لیز و پروتئین مورد نظر توسط ستون Ni و تحت شرایط دناتوره ­کننده تخلیص شد. تحت این شرایط به دلیل در معرض بودن 6-His taq در پروتئین فیوژن بیان ­شده، اتصال به ماتریکس Ni-NTA بیش­ تر شده و کارآیی فرآیند تخلیص توسط کاهش پتانسیل برای اتصالات غیراختصاصی افزایش داشت. در شکل 4 این پروتئینهای تخلیص شده توسط پیکان بر روی ژل مشخص شده است.

 

شکل 4- پروتئین­ تخلیص شده جهش یافته (ژل SDS PAGE 15%)

در تکنیک وسترن بلات به منظور تأیید پروتئینهای بیان شده حاوی برچسب 6-His ، از آنتی بادی کونژوگه علیه 6-His استفاده شد. باندهای ظاهر شده حاصل از این   آزمایش در شکل 5 نشان داده شده است. همان­طور که در ستون 6 این شکل مشخص شده است باند حدود 25 کیلو دالتون نشان­دهنده پروتئین تخلیص شده حاوی 6His-taq  می باشد که توسط ستون نیکل تخلیص شده است و به همین دلیل نسبت به سایر ستونها که مربوط به محلول های پروتئینی پس از القا  بدون انجام فرآیند تخلیص هستند، غلظت کمتری دارد.

 

 

شکل5- باندهای پروتئینی ظاهر شده روی کاغذ نیتروسلولز در وسترن بلاتینگ: ستون 1 و 2 به ترتیب حالتهای کنترلی قبل از القاء توسط IPTG  و حالت بیان فاقد وکتور نوترکیب و ستونهای 3، 4 و 5 پروتئینهای بیان شده پس از القاء توسط IPTG (1mM) را نشان می دهند. ستون 6 هم مربوط به پروتئین تخلیص شده است.


بحث

ویژگیهای ساختاری پروتئین LTP در فعالیت زیستی آن نقش مهمی را ایفاء می­کند. توانایی اتصال به یکسری ترکیبات خاص و انتقال آنها از طریق حفره هیدروفوبیکی که قادر به پذیرش زنجیر آسیل است اعمال می­ شود (21و23). مطالعات گذشته بر روی این مولکول حاکی از حفظ فعالیت بیولوژیکی در شرایطin vitro  است. در سال 2004 Cheng پتانسیل ساختاری و بیولوژیکی این پروتئین در سیستم تحویل دارویی را عنوان نمود. وی با ایجاد موتاسیون نقطه ­ای فلورسانس پروتئین را افزایش داد (5). بر اساس مطالعات Cheng (6) اعمال جهش Y45W علی رغم عدم تغییر در ساختار پروتئین، منجر به افزایش خاصیت فلورسانس شد. خاصیت فلورسانس پروتئین پس از اتصال لیگاند تغییر قابل ملاحظه ­ای نشان نمی­ دهد. در تحقیق حاضر با هدف افزایش خاصیت فلورسانس، در ژن rice nsltp2 ( Oriza sativa) برنج ایرانی جهشهای هدایت یافته مکانی ایجادگردید.اسیدآمینه تریپتوفان نسبت به تیروزین محصول کوانتومی خیلی قوی تری دارد. به همین دلیل برای بهبود حساسیت یکی از ریشه های تیروزین با اسید آمینه تریپتوفان جایگزین شد (5). از نظر ساختاری، به دلیل قدرت هیدروفوبیسیته مشابه در تیروزین و تریپتوفان، جایگزینی Y45 با تریپتوفان کونفورماسیون طبیعی پروتئین حفظ می­ شود (12) و  جهش یافته Y45W از نظر ساختاری تثبیت می­ گردد. به علاوه وجود ریشه آروماتیک برای ایفای فعالیت پروتئین rice nsLTP2 الزامی است. با توجه به موارد ذکر شده جایگزینی تیروزین با تریپتوفان، حاوی زنجیر جانبی با دو حلقه آروماتیک، به منظور افزایش خاصیت فلورسانس rice-nsLTP2 انتخاب گردید. در مطالعات بیوانفورماتیکی پروتئینها از نرم افزارهای مختلفی استفاده می شود (1و11). داده های نرم افزاری مشخص کرد ایجاد جهش Y45W علاوه بر افزایش فلورسانس، تمایل اتصالی آن را هم افزایش می دهد (جدول 1) و ردیابی درون سلولی از طریق بررسی خاصیت فلورسانس امکان پذیر خواهد بود (9).

تکنیک جهش­ زایی در جایگاه اختصاصی (SDM) تکنیکی ارزشمند جهت تعیین نقش یک ژن یا تغییر فعالیت آن می­باشد. در مطالعه حاضر به منظور انجام SDM، تکنیک SOE-PCR انجام گرفت و پس از طراحی پرایمرهای جهش زا، محصولات PCR اول و دوم، به عنوان الگو برای انجام PCR سوم با پرایمرهای رفت و برگشت اصلی (F و R) استفاده شدند. ژن کد کننده LTP2 برنج فاقد اینترون و غنی از نوکلئوتیدهای  Gو C است. به دلیل وجود تعداد زیاد این نوکلئوتیدها در توالی نوکلئوتیدی ژن ltp2 (20) در واکنش PCR برای جلوگیری از ساختارهای ثانویه پرایمرها از مواد شکننده DMSO و بتائین استفاده شد.

پس از ایجاد جهش در ژن  ltp2 توالی جهش یافته حاصل در پلاسمید pET32-a کلون شد. طراحی پرایمرهای F وR به گونه ­ای صورت پذیرفت که توالی جهش یافته حاصل بین دو جایگاه آنزیم برش KpnI و XhoI موجود در جایگاه MCS این وکتور قرار گیرد. با کمک کلون این ژن در پلاسمید pET32-a در NTD (N-terminal domain) LTP جهش یافته توالی 6-His وارد شده و پروتئین فیوژن حاصل به راحتی توسط ستون نیکل آگارز جداسازی گردید.

به منظور بیان پروتئینهای نوترکیب از سیستمهای متفاوت یوکاریوتیک (26و27) و پروکاریوتیک استفاده می شود. در این مطالعه سویه باکتریایی (BL21pLYSs(DE3 برای بیان انتخاب شد. این سویه  جهت بیان وکتورهایی مثل pET که تحت کنترل پروموتور T7 هستند، مناسب است. در تحقیق حاضر  با وجود سیستم بیانی و تحت کنترل موجود در سویه باکتریایی (BL21pLYSs(DE3، از خاصیت ضد باکتریایی nsLTP2 استفاده گردید. نهایتاً پروتئین بیان شده تولیدی در این سویه که به صورت فیوژن با His-taq است، تحت شرایط دناتوره کننده و به کمک ستون نیکل تخلیص گردید و تأیید نهایی حضور پروتئین جهش یافته متصل به 6-His توسط وسترن بلات و استفاده از آنتی بادی کونژوگه علیه 6-His انجام گرفت.

با ارتقای برخی خصوصیات در پروتئین LTP از جمله افزایش خاصیت فلورسانس (با ایجاد جهش Y45W) می­توان قابلیت استفاده از آن را افزایش داد و با تکنیک کلنینگ توسط وکتور بیانی پروکاریوتی آن را در مقیاس وسیع تولید کرد. در تحقیقات آتی امید می ­رود پس از برش آنزیمی این پروتئین با انتروکیناز و تعیین ساختارهای سه ­بعدی با کمک تکنیک هایی مثل NMR و RP-HPLC، از آن به عنوان یک حامل داروئی استفاده گردد.

تشکر و قدردانی 

مؤلفین مراتب امتنان خود از (INSF) و بخش تحقیقات سلولی و مولکولی دانشگاه اصفهان و مرکز تحقیقات پزشکی و مولکولی دانشگاه علوم پزشکی اراک به دلیل پشتیبانی تجهیزات وامکانات و کلیه همکارانی که در انجام این پژوهش یاری رساندند صمیمانه تشکر و قدردانی می نمایند.

  1. Abascal, F., Zardoya, R., and Posada, D. 2005. ProtTest: selection of best-fit models of protein evolution. Bioinformatics. 21, 2104–2105.
  2.  Bharat, B. 2006. Expression of the lipid transfer protein Ace-AMP1 in transgenic wheat enhances antifungal activity and defense responses Subhankar Roy Barman Christof Sautter, Transgenic Res. 15:435–446
  3. Carvalho, A.O. Gomes, V.M. 2007. Role of plant lipid transfer proteins in plant cell physiology. A concise review. Peptides, 28(5pp), 1144-1153.
  4. Cheng, C.S., Chen, M.N., Lai, Y.T., Chen, T., Lin, K.F., Liu, Y.J. and Lyu, P.C. 2008. Mutagenesis study of rice nonspecific lipid transfer protein 2 reveals residues that contribute to structure and ligand binding. Proteins . 70, 695–706.
  5. Cheng, C.S., Chen, M.N., Liu, Y.J., Huang, L.Y., Lin, K.F. and Lyu, P.C. 2004. Evaluation of plant non-specific lipid-transfer proteins for potential application in drug delivery. Enzyme and Microbial Technology. 35, 532-539.
  6. Cheng, H.C., Cheng, P.T., Peng, P., Lyu, P.C. and Sun, Y.J. 2004. Lipid binding in rice nonspecific lipid transfer protein-1 complexes from Oryza sativa, Protein Science. 13:2304–2315.
  7. Elmorjani, K. Lurquin, V., Lelion, A., Rogniaux, H. and Marion, D. 2004. A bacterial expression system revisited for the recombinant production of cystine-rich plant lipid transfer proteins.Biochemical and Biophysical Research Communications 316, 1202–1209.
  8. Gonorazky, A.G., Regente, M.C. and de la Canal, L. 2005. Stress induction and antimicrobial properties of a lipid transfer protein in germinating sunflower seeds., J Plant Physiol.162(6):618-24
  9. Guinness, L.P., Yan, Y., Stacey, A.,1 , Simpson, D.A., Hall, L.T.,  Maclaurin, D., Prawer, S., Mulvaney, P., Wrachtrup, J., Caruso, F., Scholten, R.E. and Hollenberg, L. C. L. 2011. Quantum measurement and orientation tracking of fluorescent nanodiamonds inside living cells, , Nature Nanotechnology.nnano. 64
  10. Hartz, C., Lauer, I., Del Mar San Miguel Moncin, M., Cistero-Bahima, A., Foetisch, K., Lidholm, J., Vieths, S. and Scheurer, S. 2010. Comparison of IgE-Binding Capacity, Cross-Reactivity and Biological Potency of Allergenic Non-Specific Lipid Transfer Proteins from Peach, Cherry and Hazelnut Int Arch Allergy Immunol. 153:335–346
  11. Keith, J.M., 2008. Methods In Molecular Biology, Bioinformatics, Structure, Function and Applications, Volume II, Australia, John Walker, Hatfield, Hertfordshire. 39
  12. Kyte, J., Doolittle, R.F., 1982. A simple method for displaying the hydropathic character of a protein. J Mol Biol. 105-32
  13. Larsen, K.L. and Winther, J.R. 2001. Surprisingly high stability of barley lipid transfer protein, LTP1, towards denaturant, heat and proteases. Federation of European Biochemical Societies 488,145-148.
  14. Liu, Y.J., Samuel, D., Lin, C.H. and Lyu, P.C. 2002. Purification and characterization of a novel 7-kDa non-specific lipid transfer protein-2 from rice (Oryza sativa). Biochemical and Biophysical Research Communications. 294, 535-540.
  15. Pellerin, V.L.,  Devaux , C., Ihorai , T., Marion,  D., Pahin, V., Joudrier, P. and Gautier , M. 1999. Production in Escherichia coli and site-directed mutagenesis of a 9-kDa nonspecific lipid transfer protein from wheat. Eur. J. Biochem. 260, 861-868. 
  16. Pii, P., Astegno, A., Peroni, E., Zaccardelli, M., Pandolfini, T.  And Crimi, M. 2009. The Medicago truncatula N5 Gene Encoding a Root-Specific Lipid Transfer Protein Is Required for the Symbiotic Interaction with Sinorhizobium meliloti. MPMI l. 22(12), 1577–1587.
  17. Reece, R.J. 2003. Analysis of Genes and Genomes, John Wiley and Sons Ltd, Southern Gate, Chichester,West Sussex PO19 8SQ, England, chapter7,P. 285
  18. Samuel, D. Liu, Y.J., Cheng, C.S. and Lyu, P.C. 2002. Solution Structure of Plant Nonspecific Lipid Transfer Protein-2 from Rice (Oryza sativa). The Journal of Biological Chemistry. 277. 38, 35267–35273.
  19. Salcedo, G., Sanches-Monge, R., Diaz-Perales, G. and Barber, D. 2004. Plant non-specific lipid transfer proteins as food and pollen allergens. J. Clin. Exp. Allergy. 34: 1336-1341.
  20. Vignolsb, F., Lund, G., Pammi, S., Trkmousaygue, D., Grellet, F.C., Kaderb, J.C., Puigdom, P.  and Delseny. M. 1994. Characterization of a rice gene coding for a lipid transfer protein (Recombinant DNA; plant; Oryza satiua; promoter sequence; gene expression) Gene, 142. 1994, 2655270
  21. Wang, S.Y., J.H. Wu, T.B. Ng, X.Y. Ye and P.F. Rao, 2004. A non –specific lipid transfer protein with antifungal and antibacterial activities from the mung bean. Peptiddes. 25: 1235-1242
  22. Yeats, T.H. and Rose, J.C. 2008. The biochemistry and biology of extracellular plant lipid-transfer proteins (LTPs). Protein Science. 17, 191–198.
  23. Zachowski, A., Guerbette, F., Grosbois, M., Jolliot-Croquin, A. and Kader, J.C. 1998. Characterisation of acyl binding by a plant lipid-transfer protein, Eur. J. Biochem. , FEBS. 257, 4432448
  24. Zoccatelli, G., Pokoj, S., Foetisch, K., Bartra, J., Valero, A.  Del Mar San Miguel-Moncin, M., Vieths, S. and Scheurer, S. 2010. Identification and characterization of the major allergen of green bean (Phaseolus vulgaris) as a non-specific lipid transfer protein (Pha v 3), Molecular Immunology 47. 1561–1568
  25. Zottich, U., Cunha M.D., Carvalho, A.O., Dias, G.B., Silva, C.M., Santos, I., Nacimento, N., Migual, E.C., Macado,O.L. and Gomes, V.M. 2011.Purification, biochemical characterization and antifungal activity of a new lipid transfer protein (LTP) from Coffea canephora seeds with α-amylase inhibitor properties. Biochim Biophys Acta.1810(4):375-83.
  26. Nazari, R. , Davoudi, N., and Barkhordari, F. 2011. Cloning of new form of human tissue plasminogen activator (K2S) in eukaryotic system. Iranian journal of biology. 24 (5): 632-639
  27. Vafa, M., Yakhchali, B., Haghnazari, A., Karkhane, A.A., Rastgar-jazi, F., and Ahmadi Danesh, H. 2011. Cloning and secretive expression of Bacillus thermocatenulatus BTL2 lipase in Pichia pastoris Using natural and yeast α factor signal sequences. Iranian journal of biology. 24 (5): 640-647