نوع مقاله: مقاله پژوهشی

نویسندگان

1 عضو هیات علمی دانشگاه تربیت مدرس

2 دانشگاه تربیت مدرس

چکیده

خانواده ژنی MYB بعنوان یکی از بزرگترین فاکتورهای رونویسی در گیاهان نقش¬های متعددی بر عهده دارند که یکی از مهمترین آنها تنظیم سطح آنتوسیانین در پیکره گیاه است. در سیب (Malus ×domestica) سه ژن MdMYB1، MdMYBA و MdMYB10 با کنترل سطح آنتوسیانین مسئول توسعه رنگ قرمز می¬باشند.در این مطالعه ضمن جداسازی یک واریانت از ژن MdMYB10، با نام MdMYB10b، از یک سیبگوشت قرمز بومی ایران الگوی بیانی آن در بافت¬های مختلف تعیین شد. این ژن در تمامی بافت¬های قرمز گیاه شامل برگ، بذر، پوست و گوشت میوه بیان شد در حالیکه در رقم کنترل(گوشت سفید) هیچ بیانی مشاهده نشد. با توجه به نتایج این مطالعه و بررسی بیوانفورماتیکی ژنهای مسئول رنگ قرمز و نیز استفاده از توالی کامل ژنوم سیب پیشنهاد شد که این سه همولوگ MYB(10,1,A)بعنوان اللهای یک لوکوس در نظر گرفته شوند. همچنین یک الگوی بیانی وابسته به بافت و ژنوتیپ ارائه شد که بر این اساس الل MdMYB1 وMdMYBA در هر دو ژنوتیپ گوشت سفید و قرمز وجود دارد و تنها در پوست عمل می¬کنند در حالیکهMdMYB10 تنها در ژنوتیپ گوشت قرمز موجود بوده و در همه¬ی بافت¬ها عملکرد دارد.

کلیدواژه‌ها

عنوان مقاله [English]

Isolation and expression analysis of variant MdMYB10b in a red flesh apple genotype and study of allelism of genes responsible for red flesh color in apple

نویسنده [English]

  • Abbas Yadollahi 1

1 Tarbiat Modares University

چکیده [English]

MYB gene family as one of the largest transcription factors in plants have various roles. One the most important of them is regulation of anthocyanin level in plant. In apple (Malus ×domestica), three genes MdMYB1,MdMYBA and MdMYB10 are responsible for developing red color by controlling anthocyanin level. In this study a variant of MdMYB10, named MdMYB10b, was isolated from an Iranian domestic red flesh apple and its expression pattern in different tissues described. This gene was expressed in all red tissues of plant including leaves, seed, fruit skin and flesh while no expression was detected in control cultivar. Regarding these results and bioinformatics examination of the red color responsible genes as well as using the whole genome sequence of apple, it was suggested that these three homologues MYBs (10,1,A) are alleles of one locus. Furthermore, a tissue and genotype specific expressionpattern was presented based on that model alleles MdMYB1and MdMYBA are located in both red and white flesh genotypes and function only in the skin while MdMYB10 is located merely in red flesh genotype and function in all tissues.

کلیدواژه‌ها [English]

  • Anthocyanin
  • Allele
  • Gene expression
  • Red Flesh apple
  • Red color
  • MdMYB10

جداسازی و بررسی بیان واریانت MdMYB10b در سیب گوشت قرمز و مطالعه آللیسم ژنهای مسئول رنگ قرمز در سیب

ابراهیم محمودی1، عباس یداللهی2٭ و بهرام محمدسلطانی3

1 تهران، دانشگاه تربیت مدرس، گروه بیوتکنولوژی

2 تهران، دانشگاه تربیت مدرس، گروه علوم باغبانی

3 تهران، دانشگاه تربیت مدرس، گروه ژنتیک

تاریخ دریافت: 22/3/90               تاریخ پذیرش: 23/12/91 

چکیده

خانواده ژنی MYB به عنوان یکی از بزرگترین فاکتورهای رونویسی در گیاهان نقشهای متعددی بر عهده دارند که یکی از مهم ترین آنها تنظیم سطح آنتوسیانین در پیکره گیاه است. در سیب (Malus ×domestica) سه ژن MdMYB1، MdMYBA و mdMYB10 با  کنترل سطح آنتوسیانین مسئول توسعه رنگ قرمز می­باشند. در این مطالعه ضمن جداسازی یک واریانت از ژن MdMYB10، با نام MdMYB10b، از یک سیب گوشت قرمز بومی ایران الگوی بیانی آن در بافتهای مختلف تعیین شد. این ژن در تمامی بافتهای قرمز گیاه شامل برگ، بذر، پوست و گوشت میوه بیان شد در حالی که در رقم کنترل(گوشت سفید) هیچ بیانی مشاهده نشد. با توجه به نتایج این مطالعه و بررسی بیوانفورماتیکی ژنهای مسئول رنگ قرمز و نیز استفاده از توالی کامل ژنوم سیب پیشنهاد شد که این سه همولوگ MYB(10,1,A) به عنوان آللهای یک لوکوس در نظر گرفته شوند. همچنین یک الگوی بیانی وابسته به بافت و ژنوتیپ ارائه شد که بر این اساس آلل MdMYB1 وMdMYBA در هر دو ژنوتیپ گوشت سفید و قرمز وجود دارد و تنها در پوست عمل می­کنند در حالی کهMdMYB10 تنها در ژنوتیپ گوشت قرمز موجود بوده و در همه بافتها عملکرد دارد.

واژه­های کلیدی: آنتوسیانین، آلل، بیان ژن، سیب گوشت قرمز ، رنگ قرمز ، MdMYB10.

* نویسنده مسئول، تلفن: 48292091، پست الکترونیکی: Yadollah@modares.ac.ir

مقدمه

 

سیب گوشت قرمز ایرانی یکی از گونه های سیب بومی ایران است که بدلیل وجود مقادیر بالای آنتوسیانین در کورتکس، گوشت قرمز رنگ دارد و همین امر سبب تمایز آن از سیب معمولی و ایجاد ظاهر جذاب شده است(18). آنتوسیانین­ها رنگدانه­هایی هستند که به عنوان یک ترکیب ثانویه، از فلاونوئیدها مشتق می‌شوند. این ترکیبات به همراه کارتنوئیدها به صورت رنگ دهنده‌های طبیعی در گیاهان ساخته ومسئول طیف وسیعی از رنگها از قبیل نارنجی، آبی، بنفش و قرمز در گل، میوه، بذر و اندامهای رویشی گیاهان می­باشد (2).آنتوسیانین نقش مؤثری درجلوگیری ازبیماریهای قلبی،سرطان ودیابت دارد و همچنین در ایجاد مقاومت در مقابل آفات در گیاهان نیز نقش دارند (10 و 11). آنزیمهای مسیر آنتوسیانین (CHS, F3H, DFR, ANS, UFGT) توسط فاکتورهای رونویسی MYB تنظیم می شوند (7). MYB ها یکی از بزرگترین خانواده­های ژنی در گیاهان است که دارای یک تا سه تکرار محافظت شده (R1، R2، R3) در دمین متصل شونده به DNA بوده و اغلب با فاکتورهای رونویسی bHLH همکاری می­کنند (8 و 12).در گیاه آرابیدوپسیس (Arabidopsis thaliana) 125 ژن MYB شناسایی شده که ژنهای AtMYB75 و AtMYB90در تنظیم آنتوسیانین دخالت دارند (15). در انگور (Vitisvenifera) ژنهای VvMYBA1 و VvMYBA2 در کنترل آنتوسیانین نقش دارند (9 و 18). در بسیاری از گیاهان دیگر ژنهای MYB به عنوان تنظیم کننده­های آنتوسیانین نقش مؤثری در ایجاد رنگ دارند (13). در سیب ژنهای MdMYB1 و MdMYBA به عنوان مسئول ایجاد رنگ قرمز در پوست شناسایی شده­اند (1 و 16). همچنین ژن MdMYB10 که در بافت گوشت میوه بیان می­شود کنترل رنگ قرمز در این بافت را بر عهده دارد (4). وجود یک توالی ماهواره­ای در ناحیه پیشبرنده این ژن سبب افزایش سطح رونویسی آن در بافت گوشت شده است (3).

تعدادی از ارقام سیب وجود دارد که رنگ گوشت (ناحیه بین پوست میوه و هسته) آنها قرمز است و دارای مقادیر زیادی آنتوسیانین است و به صورت وحشی در جنگلهای آسیای مرکزی رشد می­کند که از جمله این ارقام می­توان به MaluspumilavarNiedzwetzkyana اشاره کرد. در واقع تجمع رنگیزه آنتوسیانین یا کاروتنوئید در کورتکس سیبهای گوشت قرمز، وجه تمایز آن با سیبهای گوشت سفید در نظر گرفته می شود. امروزه توجه زیادی به ارقام گوشت قرمز سیب در دنیا شده است زیرا به اثبات رسیده است که این ارقام خاصیت آنتی‌اکسیدانتی بسیار بالاتری نسبت به سیبهای معمولی دارند. تعدادی از ارقام سیب گوشت قرمز در چند منطقه مختلف از ایران وجود دارد که تاکنون هیچ بررسی مولکولی از نقطه نظر این صفت بر روی آنها انجام نشده است. به منظور جداسازی و تعیین توالی فاکتور رونویسی MYB10 (ژنی که به عنوان عامل تنظیم کننده آنتوسیانین در سیب گزارش شده است) و امکان استفاده این ژن در پروژه های انتقال ژن و همچنین بررسی میزان شباهت با همولگهای گزارش شده واریته­های خارجی و نیز مطالعه الگوی بیان این ژن در بافتهای مختلف واریته سیب گوشت قرمز این پژوهش انجام شد.

مواد و روشها

جمع آوری مواد گیاهی: در اردیبهشت 1388 عملیات نمونه‌گیری از درختان سیب صورت گرفت. نمونه ها از کلکسیون درختان میوه کمال‌آباد وابسته به مؤسسه اصلاح و تهیه نهال و بذر کرج انتخاب گردید. برای استخراج RNA و DNA برگهای جوان سرشاخه‌ها در ابتدای فصل رشد انتخاب و بلافاصله در ازت مایع منجمد گردید. جهت استخراج RNA، بافتهای برگ، بذر، پوست و گوشت میوه در مرحله رسیدگی (DAF 102برای B.9 و DAF120 برای خوانساری) تهیه و  بلافاصله خرد و در ازت مایع فریز شد. تمامی نمونه ها برای نگهداری بلندمدت در دمای 80- نگهداری شدند. آزمایشها بر روی کولتیوار B.9که دارای فنوتیپ گوشت قرمز و رقم خوانساری  که دارای فنوتیپ گوشت سفید بود، انجام شد.

استخراج RNA و ساخت cDNA: استخراج RNA از 500 میلی­گرم بافت هدف مطابق روش گاسیک و همکاران انجام شد (6). ساخت cDNA با استفاده از 350 نانوگرم RNA کل در حجم 20 میکرولیتر شامل 40 واحد از آنزیم M-Mulv، بافر x5، 20 واحد از RiboLock™ Rnase inhibitor، 10 میلی­مول از dNTPs، در دمای 42 درجه سانتی گراد به مدت 90 دقیقه انجام شد و در نهایت به مدت 10 دقیقه در دمای 70 درجه سانتی گراد انکوبه شد. آغازگرهای اختصاصی مورد استفاده جهت جداسازی و بررسی بیان ژن  MYB10شامل Forward (5′-ATGGAGGGATATAACGAAAACC)  و Revers (5′-TTCTTCTTTTGAATGATTCCA) بودند. واکنش زنجیره‌ای پلیمراز در حجم 25 میکرولیتر شامل بافر x10،10 میلی مولار از dNTPs ، 40 میلی مولار از MgCl2، 5 میکرومولار از هر آغازگر و 1 واحد از آنزیم تک­پلیمراز (سیناژن) انجام شد. مراحل PCR شامل واسرشته سازی اولیه در 94 درجه سانتی گراد به مدت 4 دقیقه، 35 چرخه (95 درجه سانتی گراد به مدت 40 ثانیه،  57 درجه به مدت 40 ثانیه و 72 درجه به مدت 60 ثانیه) و در نهایت در 72 درجه به مدت 15 دقیقه بود. محصولات واکنش زنجیره‌ای پلیمراز در دمای 4 درجه سانتی گراد نگهداری شدند. الکتروفورز محصولات بر روی ژل آگارز 1 درصد صورت گرفت و سپس رنگ آمیزی با اتیدیوم بروماید انجام شد.

بررسی و آنالیز: طراحی پرایمرها استفاده از نرم افزار Primer3 و نیز وب سایت http://eu.idtdna.com انجام شد. بررسی همردیفی توالیها توسط ((www.ebi.ac.uk/Tools/msa/clustalw2  Clustal Wو ترسیم درخت فیلوژنی با استفاده از نرم افزار Genetics Analysis (MEGA4)Molecular Evolutionary، نسخه 2/0/4 و استفاده از متد neighbor-joining صورت گرفت.همچنین جستجوی blast بر روی توالی کامل ژنوم سیب با استفاده از وب سایت http://www.rosaceae.org

انجام شد.

نتایج

جداسازی یک واریانت ژنMdMYB10 : ژن MdMYB10 در سنتز آنتوسیانین در گوشت میوه سیب دخالت دارد. به منظور جداسازی این ژن در ابتدا  cDNA total از بافت گوشت قرمز سیب (Malus ×domestica, cv. B.9) تهیه و سپس با استفاده از آغازگرهای اختصاصی یک کلون bp729 تکثیر و توالی یابی شد.این ژن یک پروتئین 243 اسید آمینه­ای را کد می­کند که حاوی دو دمین R1 و R2 می­باشد. بررسی هم ردیفی توالی اسیدآمینه آن با ژنهای گزارش شده دخیل در رنگ قرمز سیب نشان داد که مشابهت بالایی (99درصد) وجود دارد که به ترتیب یک اسیدآمینه باMdMYB10A وMdMYB1 و دو اسیدآمینه باMdMYB10 تفاوت دارد(شکل 1). این ژن به عنوان یک واریانت از MdMYB10 و مسئول رنگ قرمز گوشت میوه، با نام MdMYB10b ثبت گردید (AB592747.1).

 

الف)

 

 

 

 

 

 

 

 

 

 

 

 

 

 

ب)

MdMYB1          ---MEGYNENLSVRKGAWTREEDNLLRQCVEIHGEGKWNQVSYKAGLNRCRKSCRQRWLN 57

MdMYBA          ---MEGYNENLSVRKGAWTREEDNLLRQCVEIHGEGKWNQVSYKAGLNRCRKSCRQRWLN 57

MdMYB10b        ---MEGYNENLSVRKGAWTREEDNLLRQCVEIHGEGKWNQVSYKAGLNRCRKSCRQRWLN 57

MdMYB10         ---MEGYNENLSVRKGAWTREEDNLLRQCVEIHGEGKWNQVSYKAGLNRCRKSCRLRWLN 57

VvMYBA1         ---ME----SLGVRKGAWIQEEDVLLRKCIEKYGEGKWHLVPLRAGLNRCRKSCRLRWLN 53

VvMYBA2         ---MK----SLGVRKGAWTQEEDVLLRKCIEKYGEGKWHLVPLRAGLNRCLKSCRLRWLN 53

MrMYB1          ---MEG---SLGVRKGAWTVEEDTLLKLYIEKYGEGKWHQVPPRAGLNRCRKSCRLRWLN 54

ROSEA1          ---MEK--NCRGVRKGTWTKEEDTLLRQCIEEYGEGKWHQVPHRAGLNRCRKSCRLRWLN 55

ROSEA2          ---MQK--NPRGVRKGTWTKEEDILLMECIDKYGEGKWHQVPLKAGLNRCRKSCRLRWLN 55

AtMYB90         ---MEG--SSKGLRKGAWTAEEDSLLRLCIDKYGEGKWHQVPLRAGLNRCRKSCRLRWLN 55

AtMYB75         ---MEG--SSKGLRKGAWTTEEDSLLRQCINKYGEGKWHQVPVRAGLNRCRKSCRLRWLN 55

LeANT1          --------------KGSWTDEEDFLLRKCIDKYGEGKWHLVPIRAGLNRCRKSCRLRWLN 46

PhAN2           MSTSNA--SSSGVRKGAWTEEEDLLLRECIEKYGEGKWHLVPVRAGLNRCRKSCRLRWLN 58

LAP4            --MEKC--KTRGVRKGAWTYEEDKLLKACMQKYGEGKWHLVPQRAGLNRCRKSCRLRWLN 56

ZmMYBC1         -MGRRACCAKEGVKRGAWTSKEDDALAAYVKAHGEGKWREVPQKAGLRRCGKSCRLRWLN 59

ZmMYBPL         -MGRRACCAKEGVKRGAWTAKEDDTLAAYVKAHGEGKWREVPQKAGLRRCGKSCRLRWLN 59

GhMYB9          -MGRSPCCEKAHTNKGAWTKEEDDRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWIN 59

                              :*:*  :**  *   :  :*** *. :.  *** ** **** **:*

 

MdMYB1          YLKPNIKRGDFKEDEVDLIIRLHRLLGNRWSLIARRLPGRTANAVKNYWNTRLRID--S- 114

MdMYBA          YLKPNIKRGDFKEDEVDLIIRLHRLLGNRWSLIARRLPGRTANAVKNYWNTRLRID--S- 114

MdMYB10b        YLKPNIKRGDFKEDEVDLIIRLHRLLGNRWSLIARRLPGRTANAVKNYWNTRLRID--S- 114

MdMYB10         YLKPNIKRGDFKEDEVDLIIRLHRLLGNRWSLIARRLPGRTANAVKNYWNTRLRID--S- 114

VvMYBA1         YLKPDIKRGEFALDEVDLMIRLHNLLGNRWSLIAGRLPGRTANDVKNYWHSHHFKKKVQ- 112

VvMYBA2         YLKPDIKRGEFALDEVDLMIRLHNLLGNRWSLIAGRLPGRTANDVKNYWHGHHLKKKVQ- 112

MrMYB1          YLKPNIKRGEFKADEVDLMIRLHKLLGNRWSMIAGRLPGRTANDVKNYWNTHLRKNAIS- 113

ROSEA1          YLRPNIKRGRFSRDEVDLIVRLHKLLGNKWSLIAGRIPGRTANDVKNFWNTHVGKNLGE- 114

ROSEA2          YLRPNIKRGCFSKDEVDLIVRLHKLLGNKWSLIAGRIPGRTANDVKNFWNTHVGKNLGV- 114

AtMYB90         YLKPSIKRGRLSNDEVDLLLRLHKLLGNRWSLIAGRLPGRTANDVKNYWNTHLSKKHESS 115

AtMYB75         YLKPSIKRGKLSSDEVDLLLRLHRLLGNRWSLIAGRLPGRTANDVKNYWNTHLSKKHEP- 114

LeANT1          YLRPHIKRGDFEQDEVDLILRLHKLLGNRWSLIAGRLPGRTANDVKNYWNTNLLRKLNT- 105

PhAN2           YLRPHIKRGDFSLDEVDLILRLHKLLGNRWSLIAGRLPGRTANDVKNYWNTHLRKKLIA- 117

LAP4            YLNPTINRESFSEDEVDMILRLHKLLGNRWSLIAARLPGRTANDVKNYWHTHLRKKMVS- 115

ZmMYBC1         YLRPNIRRGNISYDEEDLIIRLHRLLGNRWSLIAGRLPGRTDNEIKNYWNSTLGRRAGA- 118

ZmMYBPL         YLRPNIKRGNISYDEEDLIVRLHKLLGNRWSLIAGRLPGRTDNEIKNYWNSTLGRRA--- 116

GhMYB9          YLRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLS- 118

                **.* :.*  :  :* :::::** ****:**:** *:**** * :**:*:         

 

MdMYB1          -------RMKTVKNKSQEMRKTNVIRPQPQKFNRSSYYLSSK----------EPILDHIQ 157

MdMYBA          -------RMKTVKNKSQEMRKTNVIRPQPQKFNRSSYYLSSK----------EPILDHIQ 157

MdMYB10b        -------RMKTVKNKSQEMRETNVIRPQPQKFNRSSYYLSSK----------EPILDHIQ 157

MdMYB10         -------RMKTVKNKSQEMRETNVIRPQPQKFNRSSYYLSSK----------EPILDHIQ 157

VvMYBA1         -------FQKEGRDKPQTHSKTKAIKPHPHKFSKALPRFELK----------TTAVDTFD 155

VvMYBA2         -------FQEEGRKKPQTHSKTKAIKPHPHKFSKALPRFELK----------TTAVDTFD 155

MrMYB1          -------RIKDGGEKAQQTSKVNIIKPRPRTFAKNLTWFGGKP---------TIMAASFQ 157

ROSEA1          ----DGERCRKNVMNTKTIKLTNIVRPRARTFTGLH--------------VTWPREVGKT 156

ROSEA2          ----DGERRKKNVMNTKNSKETNIIRPRARTFNGLH--------------VTWPREHGKN 156

AtMYB90         CCKSKMKKKNIISPPTTPVQKIGVFKPRPRSFSVN--NGCSHLN--GLPEVDLIPSCLGL 171

AtMYB75         CCKIKMKKRDITPIPTTPALKNNVYKPRPRSFTVN--NDCNHLN--APPKVDVNPPCLGL 170

LeANT1          --TKIVPREKINNKCGEISTKIEIIKPQRRKYFSSTMKNVTNNN------VILDEEEHCK 157

PhAN2           --PHDQKQE-SKNKAMKITEN-NIIKPRPRTFSRPAMNHVSCWNGKSCSKNTIDKNEGDT 173

LAP4            --RKEEKKE--NEKPKESMQTHEVIKPQPRTFSSHSPWLNGKYNNFVTPIVTVSTNDGNV 171

ZmMYBC1         GAGAGGSWVVVAPDTGSHATPAATSGACETGQNSAAHRADPDSAGTTTTSAAAVWAPKAV 178

ZmMYBPL         ----GGSRVVFAPDTGSHATPAAGSREMTGGQKGAAPRADLGSP----ASAAVVWAPKAA 168

GhMYB9          RGIDPATHRPLN-EASQDVTTISFSGAKEEKEKINTNSNNNPIGFITKDEKKIPVQERCP 177

 

 

MdMYB1          SAEDLST-PPQTSSSTKNGNDWWETLLEG-EDTFERAAYPSIELEEELFTSFWFDDRLSP 215

MdMYBA          SAEDLST-PPQTSSSTKNGNDWWETLLEG-EDTFERAAYPSIELEEELFTSFWFDDRLSP 215

MdMYB10b        SAEDLST-PPQTSSSTKNGNDWWETLLEG-EDTFERAAYPSIELEEELFTSFWFDDRLSP 215

MdMYB10         SAEDLST-PPQTSSSTKNGNDWWETLLEG-EDTFERAAYPSIELEEELFTSFWFDDRLSP 215

VvMYBA1         TQVSTSSKPSSASPQPNDGIIWWESLLAEHAQMDQETDFSASG--EVLIASL-WTEETAT 212

VvMYBA2         TQVSTSSKPSSTSPQPNDDIIWWESLLAEHAQMDQETDFSASG--EMLIASL-WTEETAT 212

MrMYB1          PKDNVISDLPPAPLPSENSVKWGENLFDDKEAGDEIGTYDVGGLNEEPIATFRWAEAAPA 217

ROSEA1          DEFSNVRLT-TDEIPDCEKQTQFYNDVASPQDEVEDCIQWWSK-------LLETTEDGEL 208

ROSEA2          DAFSNVRITSTTENLDYEKQKPFHNNVASTPEEVDESIRWWSN-------LLETTED-EL 208

AtMYB90         KKNNVCENSITCNKD-DEKDDFVNNLMNGDNMWLENLLGENQE----ADAIVPEATTAEH 226

AtMYB75         NINNVCDNSIIYNKD-KKKDQLVNNLIDGDNMWLEKFLEESQE----VDILVPEATTTEK 225

LeANT1          EIIS---EKQTPDASMDNVDPWWINLLENCNDDIEEDEEVVINYEKTLTSLLHEEISPPL 214

PhAN2           EIIKFSDEKQKPEESIDDGLQWWANLLANN---IEIEELVSYN----SPTLLHEETAPSV 226

LAP4            AKDSEVDTILPINGDGDSAAQPYLENPTLSSMWWESLLNVSNDKIGSCSLLLPEEYS-KL 230

ZmMYBC1         RCTGGLFFFHRDTTPAHAGETATPMAGGGGGGGGEAGSSDDCSSAASVSLRVG-SHDEPC 237

ZmMYBPL         RCTGGLFFHRRDTHTPHAGGTETPTPMMAGGGGGEARSSDDCSSAASVSPLVGSSQHDPC 228

GhMYB9          DLNLDLRISPPYYQQTQPESFKTGGRTLCFICSLGVKNSKDCT-CSTITTAAGSSSSSSS 236

 

 

MdMYB1          RSCAN---------FPEGQSRS-----------EFSFSTDLWNHSKEE------------ 243

MdMYBA          RSCAN---------FPEGQSRS-----------EFSFSTDLWNHSKEE------------ 243

MdMYB10b        RSCAN---------FPEGQSRS-----------EFSFSTDLWNHSKEE------------ 243

MdMYB10         RSCAN---------FPEGHSRS-----------EFSFSTDLWNHSKEE------------ 243

VvMYBA1         QKKG------PMDGMIEQIQGGE---------GDFPFDVGFWDTPNTQVN---HLI---- 250

VvMYBA2         QKKGTHSKTKAIKPHPHKFSKAL---------PRFELKTTAVDTFDTQVSTSSKLIHVTT 263

MrMYB1          ETVG-----TPLDEFGPSFWA------------EFPSNLDVWDFLDPLDP---------- 250

ROSEA1          GNLFE-------EAQQIG---------------------N-------------------- 220

ROSEA2          ENLFE-------DVQQTG---------------------KMSEW---------------- 224

AtMYB90         GATLA-------FDVEQL-------------------WSLFDGETVELD----------- 249

AtMYB75         GDTLA-------FDVDQL-------------------WSLFDGETVKFD----------- 248

LeANT1          NIGEG-------NSMQQGQISHENWGEFSLNLPPMQQGVQNDDFSAEID-LWNLL----- 261

PhAN2           NAES---------SLTQG-------------------GSGLSDFSVDIDDIWDLLN---- 254

LAP4            NVEN---------FLAEGPSTVG----------DFSWDSTICEFDSLLDDILN------- 264

ZmMYBC1         FSGDG-------DGDWMDDVR---------------ALASFLESDEDWLRCQTAGQLA-- 273

ZmMYBPL         FSGDG-------DGDWMDDVR---------------ALASFLESDEERLRCHTAEQLV-- 264

GhMYB9          HSNSN-------NSSGYDFLG---------------LKSGILEYRSLEMK---------- 264

 

 

شکل1- مقایسه توالی اسیدآمینه MdMYB10b با پروتئینهای دیگر MYB. آنالیز فیلوژنی مشابهت MdMYB10b را به دیگرMYBهای مسئول رنگ قرمز سیب نشان می­دهد. توالی ژنهای MYB از EMBL  یا GenBank به دست آمد و شامل Malus ×domestica, MdMYB1 (DQ886414), MdMYB10 (DQ267896), MdMYBA (AB279598.1); Vitis venifera, VvMYBA1 (BAD18977), VvMYBA2 (AB097924); Lycopersicon esculentum, LeANT1 (AAQ55181); Arabidopsis thaliana, AtMYB75 (ABB03879), AtMYB90 (NP176813); Gossypium hirsutum, GhMYB9 (AAQ55181); Zea mays, ZmMYBC1 (AF320614), ZmMYBPL (L19496); Antirrhinum majus, ROSEA1 (ABB83826), ROSEA2 (ABB83827); Morus rubra, MrMYB1 (GQ340767); Medicago truncatula, LAP4 (FJ199997); Petunia hibrida, PhAN2 (AAF66727).. می­باشد. درخت توسط نرم افزارGenetics Analysis (MEGA4)Molecular Evolutionaryو استفاده از متد neighbor-joining با bootstrap replicates 1000. ب) مقایسه توالی اسید آمینهMdMYB10b  با فاکتورهای رونویسی MYB تنظیم کننده آنتوسیانین در گیاهان دیگر. توالیها با استفاده از برنامه Clustal W مقایسه شده است. محل پیکان نشان دهنده اسید آمینه متفاوت در ژنهای MYB در سیب است.

 


بررسی بیان ژنMdMYB10b : تعیین الگوی بیان ژن در بافتهای مختلف سیب با استفاده از RT-PCR مورد بررسی قرار گرفت. همان گونه که در شکل2 نشان داده شده است در کولتیوار B9 در مرحله رسیدگی بیان این ژن در بذر، برگ، گوشت و پوست میوه قابل مشاهده است. در حالی که در کولتیوار گوشت سفید (خوانساری)که به عنوان نمونه کنترل استفاده گردید، هیچ رونوشتی از ژن MdMYB10b در هیچ بافتی مشاهده نشد (شکل2). 

 

18s

 

MdMYB10b

 

                     B.9                            خوانساری    

برگ        بذر      گوشت             برگ        بذر        پوست     گوشت

 

 

 


 

 

شکل 2- آنالیز بیان MYB10b در بافتهای مختلف دو رقم گوشت قرمز (B.9) و سفید (خوانساری) با استفاده از RT-PCR. چاهک 1 تا 4 (از راست) بیان ژن در گوشت، پوست، بذر و برگ در رقم B.9 در اواسط رسیدن را نشان می­دهد. در رقم خوانساری هیچ بیانی دیده نمی­شود (چاهک 4 تا 7).


بررسی موقعیت و ارتباط ژنهای مسول رنگ قرمز : سه ژن MdMYB10، MdMYB1 و MdMYBA به عنوان مسئول رنگ قرمز در سیب معرفی شده است که اولی در گوشت میوه و برگ و دو ژن دیگر در پوست میوه عمل می­کنند. از آنجا که موقعیت و ارتباط آنها با یکدیگر کاملاً مشخص نشده است و با توجه به مشابهت بالای این سه ژن (بیش از 98 درصد)، یک برنامه PCR طراحی و با استفاده از آنزیم LA Taq polymerase جهت بررسی امکان پیوستگی این ژنها در ژنوم سیب اجرا گردید. همه ترکیبات پرایمری که در نواحی مختلف و مجاورت ژنها طراحی شده بود در برنامه  PCRمورد استفاده قرار گرفت که در هیچ کدام از آنها محصولی مشاهده نشد. همچنین جستجو با استفاده از ناحیه پیشبرنده و ORF و cDNA ژن MYB10 و ژنهای همولوگ آن بر روی ژنوم انجام شد. این بررسی نشان داد که تنها یک کانتیگ (MDCO13323.319) به طور کامل مشابهت دارد. طول این کانتیگ kb 22 است و در انتهای کروموزوم شماره 9 (از نوکلئوتید 29465538 تا 29488265) قرار دارد. هیچ کانتیگ دیگری با مشابهت و همپوشانی قابل قبول یافت نشد.

بحث

یک لوکوس به عنوان مسئول رنگ قرمز: طول کامل یک فاکتور رونویسی R2R3-MYB جداسازی و تحت عنوان MdMYB10b نامگذاری شد. این ژن که با MdMYB10، MdMYB1 و MdMYBA مشابهت بسیار بالایی دارد. همه این ژنها در بیوسنتز آنتوسیانین نقش دارند با این تفاوت که دو ژن MdMYB1 و MdMYB1 در پوست (1 و 16) و ژن MdMYB10 در گوشت (4) شناسایی شده است. MdMYB10bوMdMYB10 هر دو در مراحل رسیدگی بیان بالایی در برگ و بافتهای میوه دارند در حالی که MdMYB1 و MdMYBA هر دو در پوست میوه بیان می­شود (1 و 16). از آنجا که توالی کدکننده  MYB1و MYBA و نیز عملکرد و بافتی که این ژنها در آن بیان می­شود کاملاً یکسان است بنابراین به عنوان یک ژن در نظر گرفته می­شوند. مشابهت بسیار بالای این ژنها (حدود 99 درصد) و عملکرد یکسان آنها (تنظیم آنتوسیانین در بافتهای قرمز) پیشنهاد می­کند که این ژنها در واقع آللهای یک ژن باشند. تاکنون هیچ شواهدی مبنی بر استقلال این ژنها گزارش نشده است. از طرف دیگر توالی کامل ژنوم سیب نیز این فرضیه را اثبات می­کند. با استفاده از توالی ژنوم مشخص گردید که تنها یک ناحیه از ژنوم (کانتیگ MDC013323.319) در انتهای کروموزوم 9 حاوی ژن MYB(10, A,1) است. همچنین جستجو بر اساس توالی پروتینی نیز تنها یک ناحیه (MDP0000259614) شناسایی گردید که در همان کانتیگ MDC013323.319 واقع است. براین اساس توالیهای دیگری نیز با درصد مشابهت کمتر شناسایی شد که نشان می دهد که احتمالاً ژنهای دیگری از خانواده ژنی MYB نیز در ژنوم سیب وجود دارد. از طرف دیگر در تمامی ارقام گوشت قرمز مورد بررسی در این تحقیق، لوکوس مورد نظر به صورت ناخالص MYB10)/ (MYB1 وجود دارد در حالی که همه ارقام گوشت سفید خالص اند )[A]MYB1/ [A](MYB1. نتایج بررسی موقعیت و ارتباط ژنهای مسول رنگ قرمز با استفاده از PCR نیز پیشنهاد می­کند که به احتمال فراوان نه تنها این ژنهای همولوگ پیوستگی ندارند بلکه هیچ گونه نسخه تکراری متوالی از هر ژن نیز در ژنوم وجود ندارد. این نتایج با انتشار توالی کامل سیب (Malus ×domestica var. Golden delicious)  در اواخر 2010 (17) به تأیید رسید. همه شواهد فوق نشان می­دهد که MYB10،  MYB1و MYBA آللهایی هستند که در یک لوکوس واقع شده و رنگ قرمز را در بافتهای مختلف سیب کنترل می کند. این پیشنهاد اخیراً نیز توسط (14) تأیید شده است.

با وجود مشابهت بالای پیشبرنده و ناحیه کدکننده [A]MYB1 و MYB10 اما تنها MYB10 سبب رنگ قرمز در برگها و گوشت میوه می­شود. اسپلی و همکاران (2007) نشان دادند که القای بیش بیان ژن MYB10 در برگهای تنباکو سبب تجمع آنتوسیانین شده است (4). در حالی که انتقال MYBA هیچ اثری بر برگهای تنباکو نداشته است (1). به نظر می رسد رنگ قرمز در سیب از یک الگوی وابسته به بافت و وابسته به ژنوتیپ تبعیت می کند. بر اساس این الگو در کولتیوارهای سیب پوست قرمز تنها MdMYB1/MdMYBA وجود دارد (همان گونه که در توالی ژنوم نشان داده شد) که در پاسخ به نور (16) در پوست بیان شده و سبب رنگ قرمز می­شود. در حالی که به نظر می رسد که نور برای بیان MdMYB10 ضروری نبوده و لذا در همه بافتها (گوشت، پوست، بذر و برگ) بیان می­شود.

 

  1. Ban, Y., C.Honda., Y.Hatsuyama., M.Igarashi, H.Bessho and T.Moriguchi, 2007. Isolation and functional analysis of a myb transcription factor gene that is a key regulator for the development of red coloration in apple skin. Plant Cell Physiology, 48: 958–970.
  2. Castaneda-Ovando, A., M. Pacheco-Hernandez., M. Paez-Hernandez.,J.  Rodriguez and C. Galan-Vidal, 2009. Chemical studies of anthocyanins: A review. Food Chemistry, 113: 859–871.
  3. Espley, R.V., C.Brendolise., D.Chagne., S.Kutty-Amma., S.Green., R.Volz., J.Putterill., H.J.Schouten., S.E.Gardiner., R.P.Hellens and A.C.Allan, 2009. Multiple repeats of a promoter segment causes transcription factor autoregulation in red apples. The Plant Cell, 21: 168–183.
  4. Espley, R.V., R.P.Hellens., J.Putterill., D.E.Stevenson., S.Kutty-Amma andA.C.Allan, 2007. Red colouration in apple fruit is due to the activity of the MYB transcription factor MdMYB10. The Plant Journal, 49: 414–427.
  5. Faramarzi S., Yadollahi A.,  Soltani B.M.  and Abdollahi M.R (2011) Evaluation of Genetic Diversity and Relationships among Iranian Red- Fleshed Apples using Microsatellite (SSR) Markers. MSc.Thesis,  Tarbiat Modares University.
  6. Gasic, K., A.Hernandes and S.S.Korban, 2004. RNA extraction from different apple tissues rich in polyphenols and polysaccharides for cDNA library construction. Plant Molecular Biology Reporter, 22: 437a-437g.
  7. Honda, C.,N.Kotoda., M.Wada., S.Kondo., S.Kobayashi., , J.Soejima., Z.Zhang., T.Tsuda and T.Moriguchi, 2002. Anthocyanin biosynthetic genes are coordinately expressed during red coloration in apple skin. Plant Physiology and Biochemistry, 40: 955–962.
  8. Jin,Hand C.Martin, 1999. Multifunctionality and diversity within the plant MYB-gene family. Plant Molecular Biology, 41: 577–585.
  9. Kobayashi, S., N.Goto-Yamamoto and H.Hirochika, 2004. Retrotransposon-induced mutations in grape skin color. Science 304, 982.

10.  Konczak,Iand W. Zhang, 2004. Anthocyanins-more than nature´ s colours. Journal of Biomedicine and Biotechnology, 5: 239–240.

11.  Makoi,J.H.J.R., A.K.Belane., S.B.M. Chimphango and F.D.Dakora, 2010. Seed flavonoids and anthocyanins as markers of enhanced plant defence in nodulated cowpea (VignaunguiculataL. Walp.). Field Crops Research, 118: 21-27.

12.  Ramsay, N.A and B.J.Glover, 2005. MYB–bHLH–WD40 protein complex and the evolution of cellular diversity. Trends in Plant Science, 10: 63-70.

13.  Romero, I., A.Fuertes., M.J.Benito., J.M. Malpica., A. Leyva and J.Paz-Ares, 1998. More than 80 R2R3-MYBregulatory genes in the genome of Arabidopsis thaliana. Plant Journal, 14: 273–284.

14.  Sekido, K., K.Yamada, K.Shiratake., H.Fukui and S.Matsumoto, 2010.MdMYB alleles responsible for apple skin and flesh color. Current Topics in Plant Biology, 11: 17 – 21.

15.  Stracke, R., M.Werber and B.Weisshaar, 2001. The R2R3-MYB gene family in Arabidopsis thaliana. Current Opinion in Plant Biology,4: 447-456.

16.  Takos, A.M., F.W.Jaffe., S.R.Jacob., J.Bogs., S.P.Robinson and A.R.  Walker,2006. Light-induced expression of a MYB gene regulates anthocyanin biosynthesis in red apples. Plant Physiology, 142: 1216–1232.

17.  Velasco, R.,A.Zharkikh., .Affourtit., A.Dhingra., A.Cestaro., A.Kalyanaraman., P. Fontana.,S.KBhatnagar.,M.Troggio.,D.Pruss and S.Salvi,Diego Micheletti,et al., 2010. The genome of the domesticated apple (Malus × domesticaBorkh.). Nature Genetics, 42: 833–839.

18.  Walker, A.R., E.Lee., J.Bogs., , D.A.J. McDavid., M.R.Thomas and S.P.Robi, 2007. White grapes arose through the mutation of two similar and adjacent regulatory genes. The Plant Journal, 49: 772–785.